BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0729.Seq (571 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 30 0.012 DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 23 2.4 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 5.6 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 5.6 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 5.6 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 5.6 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 5.6 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 5.6 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 5.6 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 5.6 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 5.6 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 7.4 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 9.8 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 30.3 bits (65), Expect = 0.012 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -2 Query: 408 VTQSYRRLLSPLGNTHMSESIY*QLMILPPQVFCWVQSWSS*QP 277 V + R+ P H+ S + PPQV C++ SWS +P Sbjct: 494 VQEVLNRVRKPTKKLHLKNSPI-SKKVRPPQVLCYITSWSQKRP 536 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 22.6 bits (46), Expect = 2.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 3 CSNCTEKETSHKRRV 47 CS CTEK+ R++ Sbjct: 75 CSKCTEKQKEGSRKI 89 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 5.6 Identities = 14/51 (27%), Positives = 19/51 (37%) Frame = +3 Query: 375 AAIASADTTGSLTKTGELLAKKESVPAVVTAPRSTPGGNGICSTAVLLLPL 527 A+ AD+T S P T P STP + ++ L PL Sbjct: 97 ASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPL 147 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 5.6 Identities = 14/51 (27%), Positives = 19/51 (37%) Frame = +3 Query: 375 AAIASADTTGSLTKTGELLAKKESVPAVVTAPRSTPGGNGICSTAVLLLPL 527 A+ AD+T S P T P STP + ++ L PL Sbjct: 97 ASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPL 147 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.4 bits (43), Expect = 5.6 Identities = 14/51 (27%), Positives = 19/51 (37%) Frame = +3 Query: 375 AAIASADTTGSLTKTGELLAKKESVPAVVTAPRSTPGGNGICSTAVLLLPL 527 A+ AD+T S P T P STP + ++ L PL Sbjct: 97 ASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPL 147 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 5.6 Identities = 14/51 (27%), Positives = 19/51 (37%) Frame = +3 Query: 375 AAIASADTTGSLTKTGELLAKKESVPAVVTAPRSTPGGNGICSTAVLLLPL 527 A+ AD+T S P T P STP + ++ L PL Sbjct: 97 ASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPL 147 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.4 bits (43), Expect = 5.6 Identities = 14/51 (27%), Positives = 19/51 (37%) Frame = +3 Query: 375 AAIASADTTGSLTKTGELLAKKESVPAVVTAPRSTPGGNGICSTAVLLLPL 527 A+ AD+T S P T P STP + ++ L PL Sbjct: 97 ASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPL 147 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.4 bits (43), Expect = 5.6 Identities = 14/51 (27%), Positives = 19/51 (37%) Frame = +3 Query: 375 AAIASADTTGSLTKTGELLAKKESVPAVVTAPRSTPGGNGICSTAVLLLPL 527 A+ AD+T S P T P STP + ++ L PL Sbjct: 53 ASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPL 103 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 5.6 Identities = 14/51 (27%), Positives = 19/51 (37%) Frame = +3 Query: 375 AAIASADTTGSLTKTGELLAKKESVPAVVTAPRSTPGGNGICSTAVLLLPL 527 A+ AD+T S P T P STP + ++ L PL Sbjct: 97 ASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPL 147 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.4 bits (43), Expect = 5.6 Identities = 14/51 (27%), Positives = 19/51 (37%) Frame = +3 Query: 375 AAIASADTTGSLTKTGELLAKKESVPAVVTAPRSTPGGNGICSTAVLLLPL 527 A+ AD+T S P T P STP + ++ L PL Sbjct: 97 ASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPL 147 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 5.6 Identities = 14/51 (27%), Positives = 19/51 (37%) Frame = +3 Query: 375 AAIASADTTGSLTKTGELLAKKESVPAVVTAPRSTPGGNGICSTAVLLLPL 527 A+ AD+T S P T P STP + ++ L PL Sbjct: 97 ASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPL 147 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.0 bits (42), Expect = 7.4 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = +1 Query: 457 WSQHQGRLLVEMEFVPLPYCF 519 WS+ G + ++ PLP F Sbjct: 41 WSEDMGSFSLPLDLEPLPSLF 61 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 20.6 bits (41), Expect = 9.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 462 TAPRSTPGGNGICSTA 509 TAPRS GG + TA Sbjct: 45 TAPRSIHGGTTVTITA 60 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,640 Number of Sequences: 336 Number of extensions: 3393 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14099535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -