BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0729.Seq (571 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 23 2.1 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 22 4.9 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 4.9 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.6 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 8.6 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 8.6 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 8.6 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 23.0 bits (47), Expect = 2.1 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -3 Query: 479 SRPWCCDHRW 450 S W C+HRW Sbjct: 375 SNGWICEHRW 384 Score = 21.0 bits (42), Expect = 8.6 Identities = 5/7 (71%), Positives = 7/7 (100%) Frame = +2 Query: 467 TKVDSWW 487 TK+D+WW Sbjct: 400 TKIDNWW 406 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 459 VTAPRSTPGGNGICSTAVLLLPL*GCCTTSLNDSSA 566 + AP S G A +L+ GC +T LN++ A Sbjct: 282 LNAPWSYMSGEKANEVATILVDDCGCNSTMLNENPA 317 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 459 VTAPRSTPGGNGICSTAVLLLPL*GCCTTSLNDSSA 566 + AP S G A +L+ GC +T LN++ A Sbjct: 282 LNAPWSYMSGEKANEVATILVDDCGCNSTMLNENPA 317 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 63 TDKGQHRQPTSFVESSP 113 T +GQ RQ + F +SSP Sbjct: 1243 TLRGQERQRSLFKDSSP 1259 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/42 (28%), Positives = 17/42 (40%) Frame = -2 Query: 294 WSS*QPYLWVSV*CRSSPGTSLRVHVPSFSM*PCSRRVTWSY 169 WS +V + C PG R + P+F P R + Y Sbjct: 393 WSRDFRRAFVRILCACCPGRVRRRYQPAFRCKPSQRFASGRY 434 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 213 KAHEPAGTCQE 245 K HE GTCQ+ Sbjct: 2 KEHEATGTCQK 12 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.0 bits (42), Expect = 8.6 Identities = 11/39 (28%), Positives = 16/39 (41%) Frame = +2 Query: 131 YRCDPIQHEEGKTYDQVTRLLQGYIENEGT*TRRDVPGE 247 + C Q + K Q QG + +E RD+P E Sbjct: 610 FNCTQYQIRDHKDVTQCISCRQGTVPDETHSACRDIPEE 648 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,837 Number of Sequences: 438 Number of extensions: 4119 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -