BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0728.Seq (717 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37145| Best HMM Match : ig (HMM E-Value=8e-07) 31 0.93 SB_10282| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 >SB_37145| Best HMM Match : ig (HMM E-Value=8e-07) Length = 323 Score = 31.1 bits (67), Expect = 0.93 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +2 Query: 2 RLIAITPSAKINKPTR*LYHGKIVRISVDSSILVECNAS 118 R I + +A+ N P Y G ++ ++ S +++ECNA+ Sbjct: 56 RFIDLRITARCNVPVTSHYQGSVMNVAEGSEVMLECNAT 94 >SB_10282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 31.1 bits (67), Expect = 0.93 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -2 Query: 221 HCLAYKKFWSVSVRWWRLVIS 159 HC + +KF S+ RWW +V+S Sbjct: 125 HCTSDRKFLSMRARWWYIVVS 145 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,740,935 Number of Sequences: 59808 Number of extensions: 499326 Number of successful extensions: 968 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 967 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -