BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0728.Seq (717 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 23 7.2 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 23 9.5 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 23.4 bits (48), Expect = 7.2 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = -3 Query: 274 SVCSTPLVYGY----FAFAMANIASRTKSSGRCQFAGG 173 S CS PL+YG+ F + RT + G +GG Sbjct: 321 SACSNPLLYGWLNDNFRKEFNELLCRTSAGGPGHGSGG 358 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +1 Query: 169 SRHQRTDTDQNFLY 210 S H+RT T+++FLY Sbjct: 383 SSHRRTGTERSFLY 396 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 754,849 Number of Sequences: 2352 Number of extensions: 16628 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -