BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0727.Seq (637 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 44 2e-06 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 26 0.35 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 24 1.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 4.3 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 7.6 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 7.6 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 7.6 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 43.6 bits (98), Expect = 2e-06 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 1/65 (1%) Frame = +1 Query: 337 PCLKVHCSAGRVCEINEHGD-AMCNCIKDCPYETDSRRMVCTNFNETWQSDCEVYRQRSY 513 PC +C G+ CE++ + A+C C++ CP R VC + + + + CE++R + Sbjct: 81 PCASKYCGIGKECELSPNSTIAVCVCMRKCPRR---HRPVCASNGKIYANHCELHRAACH 137 Query: 514 ASTTL 528 + ++L Sbjct: 138 SGSSL 142 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 25.8 bits (54), Expect = 0.35 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 367 RVCEINEHGDAMCNCIKDCPYETDSRRMVCTNFNET 474 +VC H D+ C C+ DS V NFNE+ Sbjct: 344 QVCRSRRHSDSCCLCL-------DSMNAVIRNFNES 372 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +1 Query: 358 SAGRVCEINEHGDAMCNCIKDCPYETDSRRMVC 456 + G C EH + DC E +RR +C Sbjct: 296 TTGTKCVSGEHLSVSGGALNDCHAEVVARRCLC 328 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 4.3 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 342 ARVFHVDFFVFILFIRDLVEKVVNSGYFCPWYRFSS-KLSD 223 AR+F FF+ IL +R+ + S F P Y + +LSD Sbjct: 352 ARMFKDLFFLQILDLRNNSIDRIESNAFLPLYNLHTLELSD 392 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 7.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 268 WLFLPMVSLLVQALRHSVLD 209 +LFL + LLVQA+ + V D Sbjct: 9 FLFLASLCLLVQAVPNKVAD 28 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 7.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 268 WLFLPMVSLLVQALRHSVLD 209 +LFL + LLVQA+ + V D Sbjct: 9 FLFLASLCLLVQAVPNKVAD 28 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -3 Query: 203 QPPRCPRGR 177 QPP+CPR R Sbjct: 564 QPPQCPRFR 572 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,877 Number of Sequences: 438 Number of extensions: 2921 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -