Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= pg--0727.Seq
         (637 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g64220.1 68418.m08067 calmodulin-binding protein similar to a...    27   7.9  

>At5g64220.1 68418.m08067 calmodulin-binding protein similar to
           anther ethylene-upregulated calmodulin-binding protein
           ER1 GI:11612392 from[Nicotiana tabacum]
          Length = 1050

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 12/42 (28%), Positives = 20/42 (47%)
 Frame = +3

Query: 501 PAILCLDNSDQCRGPQYHHVQIEYYGTCREMPDCTESEMSDF 626
           PA + +D    C  P +   ++ +Y TC +   C+E    DF
Sbjct: 506 PADILVDGVLCCHAPPHEVGRVPFYITCSDRFSCSEVREFDF 547


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,261,224
Number of Sequences: 28952
Number of extensions: 254155
Number of successful extensions: 680
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 668
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 680
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1305036432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)