BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0726.Seq (682 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n... 60 4e-08 UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 44 0.003 UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein;... 40 0.056 UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 38 0.23 UniRef50_Q0PVD7 Cluster: Lst1p; n=1; Pichia pastoris|Rep: Lst1p ... 35 1.6 UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lu... 33 4.9 >UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1; Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry - Gallus gallus Length = 103 Score = 60.5 bits (140), Expect = 4e-08 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +3 Query: 510 TRLALQLFLVKIFKVYSFRLRGLVRVPYRYFSSLPPRAGSG 632 TRLALQ LVK FKV SF+L+GL RV Y YFSSLPPR GSG Sbjct: 63 TRLALQWILVKGFKVDSFQLQGLERVLYCYFSSLPPRVGSG 103 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 44.0 bits (99), Expect = 0.003 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +3 Query: 72 GKCFR*CSSCDDPRISPLTSQYECPQ 149 GKCFR C S ++ RISPLTS+Y+CPQ Sbjct: 259 GKCFRSCLSPENLRISPLTSEYKCPQ 284 >UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 493 Score = 39.9 bits (89), Expect = 0.056 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 575 PRKSPVSLFFVTTSPCREW 631 PRKSPV LFFVTTSP REW Sbjct: 24 PRKSPVLLFFVTTSPGREW 42 >UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Nematostella vectensis Length = 79 Score = 37.9 bits (84), Expect = 0.23 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 63 FHQSRTKVRGSKAIRYRPSSN 1 F RTKVRGSK IRYRPSSN Sbjct: 6 FRCQRTKVRGSKTIRYRPSSN 26 >UniRef50_Q0PVD7 Cluster: Lst1p; n=1; Pichia pastoris|Rep: Lst1p - Pichia pastoris (Yeast) Length = 919 Score = 35.1 bits (77), Expect = 1.6 Identities = 20/73 (27%), Positives = 36/73 (49%) Frame = +2 Query: 80 LSLMFVLRRSKNFTSNVAIRMPPVIPINHYLGVLKTNKIEPRSYSIIPCTKYSSSIFSRF 259 +SL+ ++ K + S + IR + + YLG KT+ + + +IP ++S+ F Sbjct: 527 ISLLDSIQAVKGYQSQLKIRCSAGLQVTKYLGSFKTSNSD--ADPLIPIVTSNTSVGCLF 584 Query: 260 EHSNLLKVKLSAH 298 +H L K AH Sbjct: 585 KHDGKLSTKNDAH 597 >UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 72 Score = 33.5 bits (73), Expect = 4.9 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -2 Query: 63 FHQSRTKVRGSKAIRYRPSSN 1 FH RTKV GSK IRY PS N Sbjct: 6 FHCQRTKVGGSKMIRYHPSLN 26 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 629,135,050 Number of Sequences: 1657284 Number of extensions: 11723893 Number of successful extensions: 26075 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 25379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26072 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52892566912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -