BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0726.Seq (682 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U22831-4|AAK20066.1| 633|Caenorhabditis elegans Hypothetical pr... 28 5.4 >U22831-4|AAK20066.1| 633|Caenorhabditis elegans Hypothetical protein F47D12.5 protein. Length = 633 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +2 Query: 116 FTSNVAIRMPPVIPINHYLGVLKTNKIEPRSYSIIPC-TKYSSSIFSRFEHSNLLKVKLS 292 F N A + + HYLGV + + +E +++ KY + +RF+ S +K+ ++ Sbjct: 223 FLLNTATLTSSLKSLTHYLGVHRISSVERVLENMLHLFPKYDPDLDNRFDFSECVKIIIN 282 Query: 293 AHL 301 + L Sbjct: 283 SAL 285 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,568,815 Number of Sequences: 27780 Number of extensions: 285116 Number of successful extensions: 658 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 658 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -