BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0725.Seq (790 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 26 0.39 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 24 1.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.9 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 22 6.4 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 8.5 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 25.8 bits (54), Expect = 0.39 Identities = 18/67 (26%), Positives = 31/67 (46%) Frame = +2 Query: 26 LPNSMPARRNAATTPPNCSASRVPTKKARNSSRLSAARTRTLPTKSRTSWTRSAKVAATS 205 LP ++PA AA PP +A A ++ +A ++ L S + + R++ S Sbjct: 125 LPPTLPAAAAAALLPPQTAAMAAYLNAAAVAA--AAQQSHRLMMTSPSGFNRASVSPLIS 182 Query: 206 TKSRKPG 226 + S PG Sbjct: 183 SSSSPPG 189 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.8 bits (49), Expect = 1.6 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +3 Query: 615 SAPVTMPANSSASRSVAPMLFRTNWKSPAHSWSRPTAPVARPSRNSA 755 SA + ++ S + AP T+ SPA S +AP+ P++ +A Sbjct: 17 SAATPISSSGMTSPAAAPPPATTSSGSPASVASNASAPLHIPAKRAA 63 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 690 KSPAHSWSRPTAPVARP 740 K SW +PT P RP Sbjct: 1160 KPSTSSWQKPTKPSYRP 1176 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 350 RQTHPREGGRIRKHTQEPPA 409 R THP E GR K PA Sbjct: 351 RTTHPNEPGRFAKLLLRLPA 370 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +1 Query: 691 RVPHTLGAGRPRPSPGRA 744 +VP G GR P P R+ Sbjct: 320 QVPQLAGGGRRGPGPARS 337 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.309 0.126 0.353 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,955 Number of Sequences: 336 Number of extensions: 2598 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21376414 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits)
- SilkBase 1999-2023 -