BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0721.Seq (783 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 25 2.0 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 24 4.6 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 6.1 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 23 8.1 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 368 IRRIMDEYKVDIRFPKHGDDSIVVITGDEDNVLNA 472 I R+M+ KV + + GD V+T D N LN+ Sbjct: 538 ITRVMNNGKVALDKKRKGDRLCAVVTVDVRNALNS 572 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 24.2 bits (50), Expect = 4.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 317 DIDPRVHRRLIGLRGKNIRRIMD 385 D+DP +HR L + NI I+D Sbjct: 639 DVDPDLHRSLTWILENNITGIID 661 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 6.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -3 Query: 385 VHNSPYIFTSQTNQSSVDTWVD 320 VH P+ FT +TN + VD + + Sbjct: 664 VHVEPHCFTHKTNLTRVDLYAN 685 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 23.4 bits (48), Expect = 8.1 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +2 Query: 353 LRGKNIRRIMDEYKVDIRFPKHGDDSIVVITGDEDNVLNAKEHLLN 490 L+G + +M + D F KH +S ++IT + ++ AK L+N Sbjct: 250 LKGYEVTDMMQKALFD--FLKHRFESRIIITRVQADISLAKRSLMN 293 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 822,442 Number of Sequences: 2352 Number of extensions: 17970 Number of successful extensions: 39 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -