BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0709.Seq (776 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18000.1 68418.m02111 transcriptional factor B3 family protei... 29 3.4 At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 3.4 At1g14740.1 68414.m01762 expressed protein 29 4.5 At2g02500.1 68415.m00189 expressed protein contains Pfam profile... 28 7.9 At1g67970.1 68414.m07764 heat shock factor protein, putative (HS... 28 7.9 At1g54020.2 68414.m06155 myrosinase-associated protein, putative... 28 7.9 >At5g18000.1 68418.m02111 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 307 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +1 Query: 460 RNDRKSRHRRIKKQRRLNAWLPQASYPC 543 R +RKS ++ +KK+ + +W ++S+PC Sbjct: 135 REERKSIYKDVKKEEEIESW-SESSHPC 161 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -1 Query: 689 LSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIK 576 LS R W RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 282 LSSRRIDRW--RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At1g14740.1 68414.m01762 expressed protein Length = 733 Score = 28.7 bits (61), Expect = 4.5 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 3/83 (3%) Frame = -1 Query: 341 YCSVREEPQFRTFGSCTRP-SGRWCEATIRGLCLNASKAEASLAESGKDMLTVEPRESGG 165 + +VR F S + P SG E T+ LC N+ K SL + GK+++T S Sbjct: 46 FLNVRSNNLDGGFSSKSSPRSGN--ELTLSYLCENSGKLAESLGQKGKEVVTFSENSSYD 103 Query: 164 SK--QCDFTSRVSHSKRETRRRS 102 K + DF + + ++R++ Sbjct: 104 DKWVERDFFNLREMNPNSSKRKA 126 >At2g02500.1 68415.m00189 expressed protein contains Pfam profile: PF01128 uncharacterized protein family UPF0007; identical to GP:12697583 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase {Arabidopsis thaliana}; identical to cDNA 4-Diphosphocytidyl-2C-methyl-D-erythritol synthase (ISPD) GI:7385140 Length = 302 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 571 FSKRCQKSYHRDNWLVAAKRSSDVAF 494 FSKR +SY RD L++ K SS F Sbjct: 42 FSKRVNRSYKRDALLLSIKCSSSTGF 67 >At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5) / heat shock transcription factor, putative (HSTF5) identical to heat shock transcription factor 5 (HSF5) SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 374 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -1 Query: 281 GRWCEATIRGLCLNASKAEASLAESGKDMLTVEPRESGGSKQCD 150 G W + + +K + ++ + GKD LT+E E G+ + D Sbjct: 286 GAWEKLLLLSPSRKKTKKQENIVKKGKDDLTLEEEEEDGTMELD 329 >At1g54020.2 68414.m06155 myrosinase-associated protein, putative strong similarity to myrosinase-associated proteins GI:1769968, GI:1769970, GI:1216389,GI:1216391 from [Brassica napus]; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 372 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -3 Query: 516 SVQATLLFDPSMSALPIIAKQNSPSVGLFT 427 SV LL P + L I+ QN P+VGLFT Sbjct: 7 SVLGILLVFPLLHNLVTISGQNLPAVGLFT 36 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,167,637 Number of Sequences: 28952 Number of extensions: 360022 Number of successful extensions: 983 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 963 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 983 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1736283200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -