BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0707.Seq (672 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57380.1 68418.m07169 fibronectin type III domain-containing ... 31 0.70 At4g33630.2 68417.m04778 expressed protein 28 6.5 At4g33630.1 68417.m04777 expressed protein 28 6.5 At2g02890.1 68415.m00239 F-box family protein contains Pfam PF00... 28 6.5 At5g15410.2 68418.m01803 cyclic nucleotide-regulated ion channel... 27 8.6 At5g15410.1 68418.m01804 cyclic nucleotide-regulated ion channel... 27 8.6 At3g28880.1 68416.m03605 ankyrin repeat family protein contains ... 27 8.6 At1g64960.1 68414.m07363 expressed protein 27 8.6 At1g03080.1 68414.m00282 kinase interacting family protein simil... 27 8.6 >At5g57380.1 68418.m07169 fibronectin type III domain-containing protein / PHD finger protein-related contains Pfam profiles PF00041: Fibronectin type III domain, PF00628: PHD-finger Length = 600 Score = 31.1 bits (67), Expect = 0.70 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +1 Query: 154 DRDRVECCSSLEQESTIKERGLQRQRAKNRLSGRGPLREP 273 D+D E CS+ E ES ++E L +++A N++ GR L P Sbjct: 434 DKDNTEHCSAGEVESELEEERLVKRKA-NKIDGRDLLVTP 472 >At4g33630.2 68417.m04778 expressed protein Length = 684 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 420 PSARSFRFLPFLSRHVRRLSPSSSKSGAPFRVP 322 P +++ F P S RL+PSS +S P R+P Sbjct: 7 PPSQNLAFSPAASATSSRLTPSSKRSFYPHRLP 39 >At4g33630.1 68417.m04777 expressed protein Length = 684 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 420 PSARSFRFLPFLSRHVRRLSPSSSKSGAPFRVP 322 P +++ F P S RL+PSS +S P R+P Sbjct: 7 PPSQNLAFSPAASATSSRLTPSSKRSFYPHRLP 39 >At2g02890.1 68415.m00239 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 531 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 530 PYLFIFLNTFKYVSAHETITLINASIILKKEEYEYSTF 643 P L F TF + +E +NAS+ + +E YS+F Sbjct: 97 PALLCFCETFGSLKGYEVENHMNASVTMLEEAIMYSSF 134 >At5g15410.2 68418.m01803 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC2) identical to cyclic nucleotide-gated cation channel GI:3894399 from [Arabidopsis thaliana] Length = 593 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 6/34 (17%) Frame = -3 Query: 634 ILILFLFQYY*SIYQGYCLM------SGYIFECI 551 +L++FLFQ+ IY CLM +GYIF I Sbjct: 123 LLLIFLFQFLPKIYHCICLMRRMQKVTGYIFGTI 156 >At5g15410.1 68418.m01804 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC2) identical to cyclic nucleotide-gated cation channel GI:3894399 from [Arabidopsis thaliana] Length = 726 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 6/34 (17%) Frame = -3 Query: 634 ILILFLFQYY*SIYQGYCLM------SGYIFECI 551 +L++FLFQ+ IY CLM +GYIF I Sbjct: 256 LLLIFLFQFLPKIYHCICLMRRMQKVTGYIFGTI 289 >At3g28880.1 68416.m03605 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 762 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +2 Query: 524 RNPYLFIFLNTFKYVSAHETITLINASIILKKEEYEYSTFPCRPYSLFC 670 RN FL F + ++ET K ++ FPCR + L+C Sbjct: 646 RNSTSVFFLREFDFYQSYETCLKEGMCFWCNKNMIRWANFPCR-HKLWC 693 >At1g64960.1 68414.m07363 expressed protein Length = 1168 Score = 27.5 bits (58), Expect = 8.6 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 301 RCRKALNRNPKGSPRF 348 RCR +NRNPK RF Sbjct: 552 RCRTLINRNPKAGARF 567 >At1g03080.1 68414.m00282 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1744 Score = 27.5 bits (58), Expect = 8.6 Identities = 9/32 (28%), Positives = 21/32 (65%) Frame = +1 Query: 142 IKRIDRDRVECCSSLEQESTIKERGLQRQRAK 237 ++ + + VE C +LE ST+K+R +++ + + Sbjct: 1340 LEGLTNELVEACKNLESRSTLKDREIEQLKGR 1371 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,661,176 Number of Sequences: 28952 Number of extensions: 274645 Number of successful extensions: 594 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -