BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0702.Seq (769 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC328.01c ||SPAC3A11.01|karyopherin|Schizosaccharomyces pombe|... 27 2.2 SPAC12G12.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 9.0 >SPAC328.01c ||SPAC3A11.01|karyopherin|Schizosaccharomyces pombe|chr 1|||Manual Length = 1234 Score = 27.5 bits (58), Expect = 2.2 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +3 Query: 78 IKCFSDVFRWLVGRLLREYEIVQYIIKT*V*S--WLATESPALVYVC 212 +KCF W+ +RE IV +I + V +L T + +Y+C Sbjct: 237 LKCFKSCLSWVATDSIREANIVSHICQILVQGPIFLKTHAIDCIYIC 283 >SPAC12G12.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 977 Score = 25.4 bits (53), Expect = 9.0 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = +2 Query: 350 SSVSIEKVHIFFGSKHGPSTL*DYNSHEKLLEYEQSE 460 SSV ++H F S H L NS+ KLLE SE Sbjct: 703 SSVMKSRIHAKFESLHSRVELVVKNSYMKLLEQTISE 739 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,044,520 Number of Sequences: 5004 Number of extensions: 61283 Number of successful extensions: 139 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 139 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 369323696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -