BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0699.Seq (767 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK097411-1|BAC05040.1| 656|Homo sapiens protein ( Homo sapiens ... 31 3.4 >AK097411-1|BAC05040.1| 656|Homo sapiens protein ( Homo sapiens cDNA FLJ40092 fis, clone TESTI2003756. ). Length = 656 Score = 31.5 bits (68), Expect = 3.4 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +3 Query: 75 SMATITMKPEYPPSEVYSTSEPPPAYRHRVSTSVQIAKIAALTVVASS 218 S A ++ K PP ++S+S+P PA + + Q+ + T A+S Sbjct: 28 STAPVSGKKHRPPGPLFSSSDPLPATSYHSRDTAQVTSLIPATFTAAS 75 Score = 31.5 bits (68), Expect = 3.4 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 75 SMATITMKPEYPPSEVYSTSEPPPAYRHRVSTSVQIAKIAALTVVASS 218 S A ++ K PP ++S+S+P PA S Q+ + T A+S Sbjct: 299 STAPVSGKKHRPPGPLFSSSDPLPATSSHSRDSAQVTSLIPATFTAAS 346 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,694,175 Number of Sequences: 237096 Number of extensions: 2316706 Number of successful extensions: 5994 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5993 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9255747988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -