BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0697.Seq (450 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0695 - 13024639-13024800,13025425-13025607,13025635-13025679 31 0.32 09_04_0269 + 16265191-16265472,16265574-16266149 31 0.43 01_01_1215 + 9815918-9816218,9816772-9816912,9816988-9817106,981... 30 0.99 04_04_0516 + 25833801-25834046,25834412-25834532,25834636-258348... 29 1.3 04_03_0985 - 21438036-21438116,21438373-21438495,21438903-214389... 29 1.3 09_02_0338 + 7426999-7428322,7428390-7428646 28 4.0 05_03_0618 - 16262826-16263097,16263111-16263183 27 5.3 03_03_0229 - 15612829-15612897,15612982-15613083,15613503-156135... 27 7.0 05_04_0167 + 18668004-18668287,18668961-18669043,18669346-186694... 27 9.2 05_01_0046 + 320600-320631,320694-320733,320871-320957,321282-32... 27 9.2 03_05_0636 - 26307847-26307852,26308331-26308726,26308802-26309461 27 9.2 >02_02_0695 - 13024639-13024800,13025425-13025607,13025635-13025679 Length = 129 Score = 31.5 bits (68), Expect = 0.32 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = +1 Query: 172 HARFQLSGNSGRKHSRCCTSILRKFSGRSIVSQLTAAAMVAPTP*GDAKHHPFSTSL 342 H + L + H R + +KFSG+ +V T +V P G A HHP + +L Sbjct: 49 HVLYHLCKAFKKIHVRLVKELEKKFSGKDVVFDAT-RRIVRPLNKGSAVHHPRTRTL 104 >09_04_0269 + 16265191-16265472,16265574-16266149 Length = 285 Score = 31.1 bits (67), Expect = 0.43 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = -2 Query: 206 LPLFPLS*NRAWEPL---MESTDPQCHILQHRRPRLPL 102 LP P W PL M T P C +L++ RPRLPL Sbjct: 139 LPFAPSLVRGRWVPLVGEMARTGPLCLLLENPRPRLPL 176 >01_01_1215 + 9815918-9816218,9816772-9816912,9816988-9817106, 9817922-9818191,9818330-9818369,9818519-9818616, 9818745-9818825 Length = 349 Score = 29.9 bits (64), Expect = 0.99 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +1 Query: 169 SHARFQLSGNSGRKHSRCCTS-ILRKFSGRSIVSQLTAAAMVAPTP*GD 312 S + LS +GRK R C+ ++R SI + LT+AA+V P P GD Sbjct: 137 SQSIVSLSSFAGRKRIRVCSGFVIRWNDSTSIGTILTSAALVRP-PCGD 184 >04_04_0516 + 25833801-25834046,25834412-25834532,25834636-25834821, 25834918-25834944,25836203-25836351,25836553-25836602, 25837181-25837289,25837395-25837532,25838184-25838463, 25838533-25838656,25838994-25839003 Length = 479 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 5/53 (9%) Frame = +1 Query: 133 IWHWGSVDSISGSHARFQLSGN---SGRKH--SRCCTSILRKFSGRSIVSQLT 276 ++ WGS+D+ H+RF S N +GR H S C ++G +I++ +T Sbjct: 410 VYRWGSLDANHVGHSRFDSSENHMVTGRHHNMSDCDIDATFYWTGMAIIAIVT 462 >04_03_0985 - 21438036-21438116,21438373-21438495,21438903-21438995, 21439176-21439388,21439589-21439687,21440248-21440317, 21442549-21442619,21442817-21442954,21443034-21443132, 21444061-21444144,21444268-21444324,21444594-21444683, 21444886-21445026,21445778-21445882,21445962-21446114, 21446215-21446316,21446404-21446562,21447039-21447222, 21447336-21447418,21447523-21447588,21447736-21447793, 21447903-21448003,21448269-21448355,21449063-21449185, 21449285-21449364,21449857-21450066,21450159-21450270, 21450709-21450927,21451356-21451726,21451866-21451965, 21452544-21452752,21453232-21453337,21453435-21453767 Length = 1439 Score = 29.5 bits (63), Expect = 1.3 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 145 GSVDSISGSHARFQLSGNSGRKHSRCCTSI-LRKFSGRSIVSQLT 276 GS DS+ G R + N K C T I LRK SG + +S +T Sbjct: 668 GSKDSLVGYQVRLDSARNERTKLLFCTTGILLRKLSGNNDLSDVT 712 >09_02_0338 + 7426999-7428322,7428390-7428646 Length = 526 Score = 27.9 bits (59), Expect = 4.0 Identities = 17/47 (36%), Positives = 20/47 (42%) Frame = -2 Query: 164 LMESTDPQCHILQHRRPRLPLMQLEAPCSFNFCSLRAIRRYKSYYVD 24 LM C L HR P L + L A L+AI KSYY + Sbjct: 397 LMVQHTRNCVTLPHRNPMLVVALLAATLGLVCLLLQAIYTMKSYYCE 443 >05_03_0618 - 16262826-16263097,16263111-16263183 Length = 114 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 49 RIARREQKLKEHGASSCISGKRGRRC 126 R+ARR + LK + C G R RRC Sbjct: 11 RMARRRRWLKRRRSGHCRCGLRSRRC 36 >03_03_0229 - 15612829-15612897,15612982-15613083,15613503-15613553, 15613637-15613706,15613816-15613984,15614217-15614326, 15614443-15614510,15615412-15615480,15616649-15616692, 15616803-15617050,15617620-15617633 Length = 337 Score = 27.1 bits (57), Expect = 7.0 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 Query: 196 NSGRKHSRCCTSILRKFSGRSI 261 N+GR+H+ C+S L ++ GR I Sbjct: 200 NNGRQHTGSCSSPLTRYLGRDI 221 >05_04_0167 + 18668004-18668287,18668961-18669043,18669346-18669434, 18670085-18670158,18670234-18670284,18671486-18671553, 18671666-18672234,18672333-18672383 Length = 422 Score = 26.6 bits (56), Expect = 9.2 Identities = 16/53 (30%), Positives = 19/53 (35%) Frame = -2 Query: 302 GVGATMAAAVNCDTMLRPLNFRSMLVQQRLCFLPLFPLS*NRAWEPLMESTDP 144 G T A DT +N +LVQ+ LP W P S DP Sbjct: 331 GKTVTPVPATGHDTTAVNMNVNGLLVQRAPYTLPSVTAQMKNTWNPADPSADP 383 >05_01_0046 + 320600-320631,320694-320733,320871-320957,321282-321378, 321532-321823,321850-321990,322285-322390 Length = 264 Score = 26.6 bits (56), Expect = 9.2 Identities = 16/55 (29%), Positives = 22/55 (40%) Frame = +1 Query: 55 ARREQKLKEHGASSCISGKRGRRCCNIWHWGSVDSISGSHARFQLSGNSGRKHSR 219 A++ + E S G G + W+W D SGS + FQ S SR Sbjct: 87 AQKWKNFDEDDCSDTPYGNFGGKRSFTWYWPGEDDESGSPSGFQWRDESQSNKSR 141 >03_05_0636 - 26307847-26307852,26308331-26308726,26308802-26309461 Length = 353 Score = 26.6 bits (56), Expect = 9.2 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +1 Query: 55 ARREQKLKEHG-ASSCISGKRGRRCCNIWHWGSVDSISG 168 A RE + ++G A + G R N W G DS+SG Sbjct: 44 ALRESSVSQNGMAPPEPTAHEGHRASNSWSSGDTDSVSG 82 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,895,232 Number of Sequences: 37544 Number of extensions: 208504 Number of successful extensions: 490 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 490 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 871620292 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -