SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= pg--0697.Seq
         (450 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s...    23   5.0  
AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.          23   6.6  
AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr...    22   8.7  

>AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl
           symporter protein.
          Length = 1127

 Score = 23.0 bits (47), Expect = 5.0
 Identities = 14/39 (35%), Positives = 16/39 (41%)
 Frame = +1

Query: 187 LSGNSGRKHSRCCTSILRKFSGRSIVSQLTAAAMVAPTP 303
           LS N        C S+ R  S  S  S L+    VAP P
Sbjct: 853 LSHNKVSSLHGSCDSLSRNVSQASSTSDLSKTISVAPDP 891


>AY578801-1|AAT07306.1|  506|Anopheles gambiae dSmad2 protein.
          Length = 506

 Score = 22.6 bits (46), Expect = 6.6
 Identities = 5/12 (41%), Positives = 8/12 (66%)
 Frame = +1

Query: 124 CCNIWHWGSVDS 159
           CC +W W  ++S
Sbjct: 88  CCRLWRWPDLNS 99


>AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1
           precursor protein.
          Length = 1623

 Score = 22.2 bits (45), Expect = 8.7
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -1

Query: 363 NRKGPILERCRE 328
           NR GP  ERC+E
Sbjct: 373 NRDGPNCERCKE 384


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 415,013
Number of Sequences: 2352
Number of extensions: 7920
Number of successful extensions: 10
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 38268990
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -