BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0692.Seq (768 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 23 7.9 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 23 7.9 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 23.4 bits (48), Expect = 7.9 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +1 Query: 421 FGPTRGGFTAVGVVGKLTKL-DHLEEVKVVKGFRREPAEGSLTCVVLCVICKYFIYLFIY 597 F T G G++ L L +L++ + + R+P +L CVV+ C + + Sbjct: 138 FALTLVGLFVPGIITSLLNLLMYLDDARRNRR-DRQPCCSTLLCVVVVPFCCRYWHSLRL 196 Query: 598 IYAC 609 YAC Sbjct: 197 SYAC 200 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 23.4 bits (48), Expect = 7.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 476 LVNFPTTPTAVKPPRVGPKTS 414 LVN T T PP V P TS Sbjct: 398 LVNGGTPSTTTMPPSVAPTTS 418 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 789,769 Number of Sequences: 2352 Number of extensions: 16950 Number of successful extensions: 40 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -