BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0692.Seq (768 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF024494-12|AAB70332.3| 332|Caenorhabditis elegans Serpentine r... 31 0.90 AL032647-1|CAA21688.2| 470|Caenorhabditis elegans Hypothetical ... 29 3.6 >AF024494-12|AAB70332.3| 332|Caenorhabditis elegans Serpentine receptor, class u protein28 protein. Length = 332 Score = 31.1 bits (67), Expect = 0.90 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +1 Query: 469 LTKLDHLEEVKVV--KGFRREPAEGSLTCVVLCVICKYFIYLFIYIYACIHSIVLNFY 636 L KL HL+ + + AE SLT + +IC Y I I A ++SI ++Y Sbjct: 230 LVKLAHLKSTTAAHTRSQKSHKAEVSLTVTTVSMICSYLSNSMIVIAAQLNSIEYSYY 287 >AL032647-1|CAA21688.2| 470|Caenorhabditis elegans Hypothetical protein Y57A10B.1 protein. Length = 470 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 508 KGFRREPAEGSLTCVVLCVICKYFIYLFIYIYACIHS 618 + +RRE AE L+ V L +F+ F+ +YA + S Sbjct: 370 ESYRREEAENVLSTVTLIAAMVFFLSFFLAMYAHVKS 406 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,948,724 Number of Sequences: 27780 Number of extensions: 352333 Number of successful extensions: 892 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 890 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1840614650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -