BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0689.Seq (772 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 8.2 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 8.2 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 8.2 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.4 bits (43), Expect = 8.2 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -3 Query: 254 SLWPQHNQL*LDHQSYHDFPYPSRRHLIQCPRKEESAFL 138 +LWPQ + + FPY S + I + E + FL Sbjct: 70 ALWPQPTSVTKISSTLLKFPYRSIKFNIPDEKNEVNDFL 108 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +2 Query: 122 IWDLIKEKLILPFLDIELNVYD 187 I D I ++LI+P + E+N+++ Sbjct: 512 ILDNIYDQLIMPRIQAEVNIWN 533 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 194 MENRDKTDDQVTIDC 238 +EN ++ DQ T DC Sbjct: 567 IENVERASDQATYDC 581 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,204 Number of Sequences: 336 Number of extensions: 4088 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20753800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -