BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0682.Seq (755 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces ... 30 0.41 SPAC4A8.08c |vas1||mitochondrial valine-tRNA ligase Vas1|Schizos... 27 3.8 SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch... 26 5.0 SPBC8E4.04 |||aldo/keto reductase involved in pentose catabolism... 26 5.0 SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosa... 26 6.7 SPBC354.05c |sre2||membrane-tethered transcription factor |Schiz... 26 6.7 SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 25 8.8 >SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces pombe|chr 1|||Manual Length = 345 Score = 29.9 bits (64), Expect = 0.41 Identities = 15/57 (26%), Positives = 26/57 (45%) Frame = +2 Query: 119 TSNFAIRIHPVIPINHYLGVLKTNKIEPRSYSIIPCTKYSSSIFSRFEHSNLFKVKL 289 T F +++ +P + G+ +P I C KY S+ +S HS L ++L Sbjct: 208 TRKFLVKLAKALPDAKFFGIFDW---DPHGLCIYSCFKYGSNAYSHEPHSQLRNLQL 261 >SPAC4A8.08c |vas1||mitochondrial valine-tRNA ligase Vas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 950 Score = 26.6 bits (56), Expect = 3.8 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -3 Query: 735 LPWLSRVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGEVVTKN 598 +P +S V + IPER+ + L P + H EVV +N Sbjct: 757 VPCISGVMLHSKIIPERKNSEFLSFPTSQQECLLVHDNQAEVVVQN 802 >SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 845 Score = 26.2 bits (55), Expect = 5.0 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +2 Query: 557 LIPITRPRKSPVSLFFVTTSPCREWVICAPAAFL 658 +IPI + KS +SL F+T SPC + IC+ A L Sbjct: 45 IIPIAQ--KSNISLPFLTLSPC-SFTICSLRARL 75 >SPBC8E4.04 |||aldo/keto reductase involved in pentose catabolism |Schizosaccharomyces pombe|chr 2|||Manual Length = 325 Score = 26.2 bits (55), Expect = 5.0 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Frame = +2 Query: 95 VLRRSKNFTSNFAIRIHPVIPINHYLGVLKTNKIEPRSYSIIPCTK--YSSSIFSRFEHS 268 VL+ +K + + +HP +P YL K +I +YS + Y+S I EH Sbjct: 176 VLKIAKVKPTIHQMELHPYLPQTEYLEKHKKLQIHVSAYSPLANQNDAYNSDISKLIEHK 235 Query: 269 NLFKV 283 L + Sbjct: 236 TLVDI 240 >SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1076 Score = 25.8 bits (54), Expect = 6.7 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 184 FQNSEVMINRDNWVYSYCEVRGEI 113 F +E +++ + SYC+VRG I Sbjct: 267 FVETETILDSSKYCVSYCQVRGSI 290 >SPBC354.05c |sre2||membrane-tethered transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 793 Score = 25.8 bits (54), Expect = 6.7 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +2 Query: 92 FVLRRSKNFTSNFAIRIHPVIPINHYLGVLK-TNKIEPRSYSIIPCTKY 235 F ++ S + +++ +I HP +PINH K N+ + +P TK+ Sbjct: 149 FEVKNSLHDSTDLSITHHPHLPINHQGNTWKHANESLQSNQGPVPNTKF 197 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 25.4 bits (53), Expect = 8.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 741 LRLPWLSRVTGNQGSIPEREPEKRLP 664 LRL +L + NQ S E++ EKR+P Sbjct: 283 LRLQFLIQQRNNQSSNEEQKQEKRVP 308 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,939,704 Number of Sequences: 5004 Number of extensions: 58861 Number of successful extensions: 154 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -