BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0681.Seq (691 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 2.1 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 23 3.6 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 6.3 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 8.4 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 23.4 bits (48), Expect = 2.1 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -1 Query: 427 DLLVSEFLS--EVGHDVAQLGRGDEAVAVLVE 338 DL S+ L E+ HDVA G+G E V++ V+ Sbjct: 163 DLNTSQLLKQVEIPHDVATTGKG-ELVSLTVQ 193 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 22.6 bits (46), Expect = 3.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 170 DEVARTEPHRSRTSRHDQ*SRRGRKRHDNFPEFLTMMAR 286 DE R + H + + + R+ HDN P FL+ +R Sbjct: 95 DEEKRYQEHPNGKILRELQTDYDRRLHDNSPSFLSDHSR 133 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -3 Query: 317 FLPRYPCPSSCAPSLSRTRESY 252 F P Y P++CAP + Y Sbjct: 1803 FSPEYDDPANCAPEEDQYGSQY 1824 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 299 CPSSCAPSLSRTRESYRAVSVR 234 CP C P L +++ S + V+ R Sbjct: 347 CPLHCKPELGQSQSSPKFVARR 368 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,995 Number of Sequences: 438 Number of extensions: 2479 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -