BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0575.Seq (762 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_01_0019 + 403078-404211 31 1.3 12_01_0861 + 8153108-8153266,8154633-8155136 29 3.1 10_06_0002 + 9382559-9382937,9383008-9383180,9386752-9386901,938... 29 3.1 03_03_0090 + 14367033-14367279,14367402-14368205,14368314-143700... 29 5.3 04_01_0178 + 2006369-2006494,2006582-2006664,2007693-2007819,200... 28 7.1 01_05_0005 - 16886553-16886946,16887079-16887404 28 9.3 >09_01_0019 + 403078-404211 Length = 377 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = -1 Query: 711 GESGFDSGEGA*ETATTSKEGSRRANYPLPARGGSDEK*RYG 586 G S DSG GA ++A K SRR + GSD R+G Sbjct: 321 GASDGDSGSGASDSADDRKRSSRRRRHRKSESSGSDGDERHG 362 >12_01_0861 + 8153108-8153266,8154633-8155136 Length = 220 Score = 29.5 bits (63), Expect = 3.1 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +2 Query: 587 PYRYFSSLPPRAGSG*FARLLPSLDVVAVSQAPSPESNP--DSPLPVTTMVVAE 742 P SS P G RL S +VA+ + P P S+P D P TT+ + E Sbjct: 94 PRSLLSSPSPHCQEGHDPRLCVSAGLVAIPRCPPPTSSPSLDPPESSTTVALIE 147 >10_06_0002 + 9382559-9382937,9383008-9383180,9386752-9386901, 9387180-9387325,9387416-9387572,9387720-9387778, 9388204-9388360,9389001-9389150,9389280-9389416, 9390071-9390217,9390292-9390393,9390742-9390799, 9391997-9392034,9392124-9392250,9392320-9392493, 9393125-9393256,9393940-9394049,9394752-9394812, 9395036-9395213,9395326-9395531,9395796-9395915, 9396496-9396594,9396983-9397204,9397482-9397621, 9397741-9397852,9398021-9398071,9398151-9398240, 9398397-9398567,9398663-9398815,9399774-9399950, 9400045-9400182,9400295-9400365,9400739-9400838, 9401324-9401380,9401469-9401525,9401619-9401699, 9401782-9401864,9401975-9402110 Length = 1632 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/65 (26%), Positives = 31/65 (47%) Frame = +2 Query: 287 CRPTSTXXEEHRDRILILNRRFLERRLTDDMLRKRVSITADACTDSAAHKCNYELFNRNN 466 C + + D+ L+L R+ + MLR +TA+A +++ K E ++NN Sbjct: 1045 CAAAKSAAQSEHDKNLLLQRQLDDSLREITMLRSSKIMTAEAERENSNLKNLVESLSKNN 1104 Query: 467 FSIRY 481 S+ Y Sbjct: 1105 SSLEY 1109 >03_03_0090 + 14367033-14367279,14367402-14368205,14368314-14370039, 14370135-14370219,14370398-14370457,14370744-14370836 Length = 1004 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 157 INHYLGVLKTNKIEPRSYSIIPCTKYSSSIFSPFE 261 I H L +LK KI P +I C +YS S F+ Sbjct: 819 ILHALHILKAEKIFPTESNIADCIRYSEMNISGFD 853 >04_01_0178 + 2006369-2006494,2006582-2006664,2007693-2007819, 2008579-2008638,2009606-2009735,2009821-2010047, 2010226-2010318,2010395-2010466,2011392-2011532, 2012045-2012047,2012387-2012443,2012909-2012995, 2013081-2013116 Length = 413 Score = 28.3 bits (60), Expect = 7.1 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +1 Query: 139 IHPVIPINHYLGVLKTNKIEPRSYSIIPCTKYSSSIFSPFEHSNXF 276 I V P H+L N + P YSS+I PF H+N F Sbjct: 53 IKMVPPGPHFLYYCSPNSYGQNNLHEKPHIDYSSTICDPFRHANEF 98 >01_05_0005 - 16886553-16886946,16887079-16887404 Length = 239 Score = 27.9 bits (59), Expect = 9.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 458 RNNFSIRYWSWNYRGC 505 R+N S RYW W GC Sbjct: 90 RSNSSFRYWRWQPHGC 105 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,696,105 Number of Sequences: 37544 Number of extensions: 413219 Number of successful extensions: 1099 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1099 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2039640244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -