BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0575.Seq (762 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.063 SB_32453| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 9.5 >SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 61.7 bits (143), Expect = 6e-10 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -3 Query: 112 SWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVL 2 SWI RRT+AKAFAK VFINQERKLE RRR DT LVL Sbjct: 4 SWIYERRTTAKAFAKNVFINQERKLEDRRRSDTVLVL 40 >SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 54.8 bits (126), Expect = 7e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 97 RRTSAKAFAKGVFINQERKLEVRRRLDTALVL 2 RRT+AKAFAK VFINQERKLE RRR DT LVL Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVL 40 >SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 54.8 bits (126), Expect = 7e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 97 RRTSAKAFAKGVFINQERKLEVRRRLDTALVL 2 RRT+AKAFAK VFINQERKLE RRR DT LVL Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVL 40 >SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 54.8 bits (126), Expect = 7e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 97 RRTSAKAFAKGVFINQERKLEVRRRLDTALVL 2 RRT+AKAFAK VFINQERKLE RRR DT LVL Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVL 40 >SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 54.8 bits (126), Expect = 7e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 97 RRTSAKAFAKGVFINQERKLEVRRRLDTALVL 2 RRT+AKAFAK VFINQERKLE RRR DT LVL Sbjct: 11 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVL 42 >SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 94 RTSAKAFAKGVFINQERKLEVRRRLDTALVL 2 RT+AKAFAK VFINQERKLE RRR DT LVL Sbjct: 29 RTTAKAFAKNVFINQERKLEDRRRSDTVLVL 59 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.0 bits (109), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 94 RTSAKAFAKGVFINQERKLEVRRRLDT 14 RT+AKAFAK VFINQERKLE RRR DT Sbjct: 2 RTTAKAFAKNVFINQERKLEDRRRSDT 28 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +2 Query: 659 DVVAVSQAPSPESNPDSPLPVTTM 730 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.3 bits (95), Expect = 4e-04 Identities = 22/33 (66%), Positives = 26/33 (78%), Gaps = 1/33 (3%) Frame = -3 Query: 97 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVL 2 R+T+ ++ AK VFINQERKLE RRR DT LVL Sbjct: 8 RKTNYCESIAKNVFINQERKLEDRRRSDTVLVL 40 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 119 VKFLDRRKTNISESICQRCFHQSRTKV 39 VKFLD RKTN ESI + F K+ Sbjct: 2 VKFLDLRKTNYCESIAKNVFINQERKL 28 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +2 Query: 668 AVSQAPSPESNPDSPLPVTTM 730 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/33 (60%), Positives = 25/33 (75%), Gaps = 1/33 (3%) Frame = -3 Query: 97 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVL 2 R+T+ ++ + VFINQERKLE RRR DT LVL Sbjct: 8 RKTNYCESICQDVFINQERKLEDRRRSDTVLVL 40 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 119 VKFLDRRKTNISESICQRCFHQSRTKV 39 VKFLD RKTN ESICQ F K+ Sbjct: 2 VKFLDLRKTNYCESICQDVFINQERKL 28 >SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 119 VKFLDRRKTNISESICQRCFHQSRTKV 39 VKFLD RKTN ESICQ CF K+ Sbjct: 2 VKFLDLRKTNYCESICQECFINQERKL 28 Score = 36.3 bits (80), Expect = 0.027 Identities = 19/33 (57%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = -3 Query: 97 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVL 2 R+T+ ++ + FINQERKLE RRR DT LVL Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVL 40 >SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 119 VKFLDRRKTNISESICQRCFHQSRTKV 39 VKFLD RKTN ESICQ CF K+ Sbjct: 2 VKFLDLRKTNYCESICQECFINQERKL 28 Score = 36.3 bits (80), Expect = 0.027 Identities = 19/33 (57%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = -3 Query: 97 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVL 2 R+T+ ++ + FINQERKLE RRR DT LVL Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVL 40 >SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 36.3 bits (80), Expect = 0.027 Identities = 19/33 (57%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = -3 Query: 97 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVL 2 R+T+ ++ + FINQERKLE RRR DT LVL Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVL 40 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -2 Query: 116 KFLDRRKTNISESICQRCFHQSRTKV 39 + L RKTN ESICQ CF K+ Sbjct: 3 EILGFRKTNYCESICQECFINQERKL 28 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.063 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 669 PFLRLPLRNRTLIPRYP 719 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_32453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 28.7 bits (61), Expect = 5.5 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +3 Query: 519 PSN--CSSLKYLKCTHSDYEAS*ESRIVIFRHYL-PVPGVGNLRA 644 PSN CS L YL+C +R+++F H L +G RA Sbjct: 523 PSNLRCSILSYLRCNKPPVTIRWRTRLIVFTHLLVSYRSIGGQRA 567 >SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = +1 Query: 181 KTNKIEPRSYSIIPCTKYSSSIFSPFEHSNXFKVKLSAHL 300 K + ++ Y+ + +S F FEH+N ++KL+ ++ Sbjct: 725 KNHSVDKHDYNNVTPLLFSQERFERFEHNNSLEIKLTVNI 764 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 470 SIRYWSWNYRGCWTRLALQLFLVKIFKVYS 559 S+R W + +R C + LA QLF V + + S Sbjct: 1135 SLRLWGYKWRKCDSTLAKQLFSVLVQAILS 1164 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 650 PSLDVVAVSQAPSPESNPDSPLP 718 P+ DV+A Q P P S D PLP Sbjct: 75 PAEDVMAAHQEPKPTSAIDQPLP 97 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,596,371 Number of Sequences: 59808 Number of extensions: 469975 Number of successful extensions: 1193 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1193 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -