BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0572.Seq (740 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0333 + 16774758-16774970,16775078-16775554,16775791-16775874 31 0.96 04_04_1035 + 30283456-30283536,30284823-30285359,30285508-302865... 30 1.7 02_05_0796 + 31800256-31800528,31800635-31800758,31802642-318027... 30 1.7 07_01_0036 + 298626-299573,299973-300239 30 2.2 11_06_0338 + 22479804-22480651,22480764-22482954 29 3.9 06_03_1167 + 28111923-28113218 29 3.9 12_02_0640 - 21447470-21448309 29 5.1 12_02_0635 - 21430245-21431156 29 5.1 01_05_0615 - 23678493-23678948,23679057-23679441,23680250-236805... 28 6.8 11_01_0665 - 5413561-5413593,5413785-5413907,5414020-5414259,541... 28 9.0 >09_04_0333 + 16774758-16774970,16775078-16775554,16775791-16775874 Length = 257 Score = 31.1 bits (67), Expect = 0.96 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 627 RASRMVAGTPRDAPRRRHDGIPEDRSG 707 R+ + G PRD PRR G+PE R+G Sbjct: 19 RSVLLARGDPRDEPRRAVGGLPERRAG 45 >04_04_1035 + 30283456-30283536,30284823-30285359,30285508-30286512, 30286718-30287042,30287563-30287818,30287901-30288117, 30288743-30289095,30289330-30289833,30291267-30292467, 30292614-30292970,30293258-30293495,30294083-30295125, 30295234-30296649,30296731-30296855,30297036-30297314, 30297352-30297382,30298957-30299022,30299447-30299689, 30299848-30299898,30299980-30300071,30300182-30300249, 30300515-30300600,30300720-30300824,30300994-30301127, 30302403-30302436,30302620-30302892,30303019-30303288, 30303384-30303974,30304065-30304214 Length = 3376 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -3 Query: 195 GGRLLDR-ELEFRVHRRHADVHLFSSGNHFDSYDHTHTADKITSTLCII 52 GG LDR E E ++H R H + H + H H D S++ I+ Sbjct: 2801 GGYDLDRIESEVQLHERKETGHCHAGEEHGHQHHHGHVHDSAVSSVSIV 2849 >02_05_0796 + 31800256-31800528,31800635-31800758,31802642-31802771, 31804336-31804414,31804848-31805133,31805273-31805385 Length = 334 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 4/43 (9%) Frame = -3 Query: 576 SKRSLARNPGPCRAGLCSPC----LA*PRTKPATPRSPEGSIF 460 S R RNP P G + C + PR P+ R+P GS+F Sbjct: 99 SAREAVRNPNPTIGGRRANCNIASMGPPRPSPSRGRAPRGSLF 141 >07_01_0036 + 298626-299573,299973-300239 Length = 404 Score = 29.9 bits (64), Expect = 2.2 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -1 Query: 515 WLDRVRSQQHRGLRRAVYFIG*NRVFHL*IEEFQCDLLYEL 393 WLDR+ S++H L R IG H F+C+ L EL Sbjct: 102 WLDRLASREHHRLERLDVNIG--AALHTPASLFRCETLVEL 140 >11_06_0338 + 22479804-22480651,22480764-22482954 Length = 1012 Score = 29.1 bits (62), Expect = 3.9 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -3 Query: 261 EDQEPHLAEADRLHNLIEELLPGGRLLD 178 E QE L E + LH I +LL GGR+ D Sbjct: 8 EKQEEALKEWEPLHESISKLLKGGRITD 35 >06_03_1167 + 28111923-28113218 Length = 431 Score = 29.1 bits (62), Expect = 3.9 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +3 Query: 594 TNTR--CPARNGSRASRMVAGTPRDAPRRRHDGIPEDRSGPGDVRRQL 731 +NTR +R G+ ASR A +P PRR+ +G D G V +L Sbjct: 237 SNTRQTLDSRQGTAASRAKARSPSPRPRRQSNGKATDTRGGNKVVDEL 284 >12_02_0640 - 21447470-21448309 Length = 279 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = -3 Query: 576 SKRSLARNPGPCRAGLCSPCLA*PRTKPATPRSPE 472 S+R AR P P R SP PRT P P SP+ Sbjct: 204 SRRPPARTPPPERRESPSPPRGRPRTPPPPPGSPK 238 >12_02_0635 - 21430245-21431156 Length = 303 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = -3 Query: 576 SKRSLARNPGPCRAGLCSPCLA*PRTKPATPRSPE 472 S+R AR P P R SP PRT P P SP+ Sbjct: 201 SRRPPARTPPPERRESPSPPRGRPRTPPPPPGSPK 235 >01_05_0615 - 23678493-23678948,23679057-23679441,23680250-23680545, 23680983-23681504 Length = 552 Score = 28.3 bits (60), Expect = 6.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 607 VPRGMGAEHHEWWQEHREMLREDAMMEYLK 696 +P+G+ A E W +HR +L +E LK Sbjct: 145 IPQGLSAHEGEKWAKHRRILNPVFQLEKLK 174 >11_01_0665 - 5413561-5413593,5413785-5413907,5414020-5414259, 5414564-5415184 Length = 338 Score = 27.9 bits (59), Expect = 9.0 Identities = 15/59 (25%), Positives = 29/59 (49%) Frame = -2 Query: 610 GHLVLVGHSLRK*AVIGQESRPVQSGIVFSVSGLTAYEASNTEVSGGQYISSDKIAFFT 434 G L+L + R + +R ++ G++ G++ + ++ E GG+ I D I F T Sbjct: 259 GPLLLKSQTGRSAVIDVGTARLIKGGVIKVFQGISKIKTNSIEFHGGKQIPFDAIVFAT 317 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,817,984 Number of Sequences: 37544 Number of extensions: 452653 Number of successful extensions: 1483 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1482 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -