BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0572.Seq (740 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 1.7 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.3 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 3.0 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 21 9.2 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 9.2 AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 21 9.2 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 Query: 322 KTSRKRIHCSSNSEPNSILRMSPMSSYRRS 411 +TSRKR CS E S + YR + Sbjct: 266 RTSRKRYSCSREREQKSYKNENSYRKYRET 295 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 2.3 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = -3 Query: 528 CSPCLA*PRTKPATPRSPEGSIFHRIKSRFSPVDRRV 418 C P LA P P + + + RFSP R V Sbjct: 213 CPPTLACPLNPNPQPLTGQQELLQDFSKRFSPAIRGV 249 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 3.0 Identities = 18/68 (26%), Positives = 30/68 (44%) Frame = +1 Query: 193 TGKQLFDQVVKTIGLREVWFLVFSTPTPRATSLGSSCTRR*CNKTSRKRIHCSSNSEPNS 372 TG++ FD + + + S PT TS+ SC R+ N + + + P+S Sbjct: 65 TGEEPFDTLDTFLRELQADLAEASQPTSTTTSVTPSCRRQRYNIAAANPLLAEKLAAPSS 124 Query: 373 ILRMSPMS 396 + SP S Sbjct: 125 --QASPTS 130 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 21.4 bits (43), Expect = 9.2 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = +1 Query: 319 NKTSRKRIHCSSNSEPNSILRMS 387 N+ + CS S+PN+++++S Sbjct: 95 NEADQLLAECSPISDPNALIKIS 117 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -3 Query: 195 GGRLLDRELEFRVHRRHADVH 133 G R + L R+HR VH Sbjct: 295 GSRFDEERLTLRIHRGRGSVH 315 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 21.4 bits (43), Expect = 9.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 281 ALGVGVLKTKNHTSRRPIVFTT 216 ALGVG++ K +S P+V T Sbjct: 23 ALGVGIMTRKVGSSVSPVVELT 44 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,538 Number of Sequences: 438 Number of extensions: 4297 Number of successful extensions: 29 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -