BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0567.Seq (783 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 25 1.1 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 25 1.1 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 25 1.1 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 25 1.1 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 3.2 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 24.6 bits (51), Expect = 1.1 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -3 Query: 664 SVYNSIGMVHHPDDVGLVGGVQGRHGDVPD 575 S Y + +HH DD+ L HGD D Sbjct: 128 SQYEFLNAIHHYDDIWLPDTYFIMHGDFKD 157 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 24.6 bits (51), Expect = 1.1 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -3 Query: 664 SVYNSIGMVHHPDDVGLVGGVQGRHGDVPD 575 S Y + +HH DD+ L HGD D Sbjct: 128 SQYEFLNAIHHYDDIWLPDTYFIMHGDFKD 157 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 24.6 bits (51), Expect = 1.1 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -3 Query: 664 SVYNSIGMVHHPDDVGLVGGVQGRHGDVPD 575 S Y + +HH DD+ L HGD D Sbjct: 179 SQYEFLNAIHHYDDIWLPDTYFIMHGDFKD 208 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 24.6 bits (51), Expect = 1.1 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -3 Query: 664 SVYNSIGMVHHPDDVGLVGGVQGRHGDVPD 575 S Y + +HH DD+ L HGD D Sbjct: 128 SQYEFLNAIHHYDDIWLPDTYFIMHGDFKD 157 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 497 GSVQRFIWNFFRLENEHLNNC 559 G + FIW+ RLE E +C Sbjct: 731 GKLMAFIWDSSRLEFEAAQDC 751 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,569 Number of Sequences: 438 Number of extensions: 4271 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -