BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0566.Seq (683 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 27 0.17 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 25 0.67 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 24 1.6 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 1.6 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 2.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 4.7 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 4.7 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 8.3 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 8.3 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 27.1 bits (57), Expect = 0.17 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = -1 Query: 353 SLLRGDTVDCESALNIID*TKQFISLLN*DNIH 255 SLL+ +TV C+ A++++ + +++ DNIH Sbjct: 381 SLLKENTVTCQEAMHMLKNADSQLLVISDDNIH 413 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.0 bits (52), Expect = 0.67 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 590 RDIPAPSTLCTSRTPRDTPSP 652 RD+P ST T+ RDT +P Sbjct: 137 RDLPGKSTTTTAEVKRDTINP 157 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 624 DVHNVEGAGMSLAGHDV 574 DVH V GAG + HDV Sbjct: 110 DVHGVIGAGHWIGDHDV 126 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 590 RDIPAPSTLCTSRTPRDTPSP 652 RD+P ST T RDT +P Sbjct: 137 RDLPGKSTTTTVEVKRDTINP 157 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.0 bits (47), Expect = 2.7 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -1 Query: 395 RSGRHTLDFTQLVLSLLRGDTVDCESALNIID*TKQFISL 276 R G+ + T L+ ++L + CE +NI K ++SL Sbjct: 75 RYGQSAVGLTFLLGAILVQVAIICEGVMNIQKDNKSYLSL 114 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 148 RLKYALTGNEVLKIVKQRLIKVDGKVRTDPTYPA 249 R K+ LTG L K RL+ + P +P+ Sbjct: 182 RTKHRLTGETRLSATKGRLVITEPVGSVRPKFPS 215 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 158 YFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLS 57 Y R +R T +H ++ +DG+G Y S S Sbjct: 83 YNRMDMRNATYYQHQQDHGSGMDGMGGYRSASPS 116 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -3 Query: 447 LGSGWCGHHALPSTEHS*VRSPH 379 +G G HA P HS +PH Sbjct: 419 MGHGHSHIHATPHHHHSHAATPH 441 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +3 Query: 36 RSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPE 143 +S++ DV ++WR + E NR+ R++ + E Sbjct: 261 QSETYDVLRSWRNLMDEHSNRTNSDPRMILTEAYTE 296 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,971 Number of Sequences: 438 Number of extensions: 4734 Number of successful extensions: 12 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -