BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0565.Seq (758 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g33040.1 68415.m04052 ATP synthase gamma chain, mitochondrial... 43 3e-04 At4g04640.1 68417.m00679 ATP synthase gamma chain 1, chloroplast... 38 0.005 At1g15700.1 68414.m01884 ATP synthase gamma chain 2, chloroplast... 36 0.029 At1g24807.1 68414.m03108 anthranilate synthase beta subunit, put... 28 0.68 At2g34990.1 68415.m04293 zinc finger (C3HC4-type RING finger) fa... 31 0.83 At5g57890.1 68418.m07242 anthranilate synthase beta subunit, put... 28 5.9 At5g19130.2 68418.m02277 GPI transamidase component family prote... 28 5.9 At5g19130.1 68418.m02276 GPI transamidase component family prote... 28 5.9 At2g04400.1 68415.m00444 indole-3-glycerol phosphate synthase (I... 28 5.9 At1g25220.1 68414.m03130 anthranilate synthase beta subunit (ASB... 28 5.9 At1g25155.1 68414.m03123 anthranilate synthase beta subunit, put... 28 5.9 At1g25083.1 68414.m03118 anthranilate synthase beta subunit, put... 28 5.9 At1g24909.1 68414.m03112 anthranilate synthase beta subunit, put... 28 5.9 At4g02350.1 68417.m00319 exocyst complex subunit Sec15-like fami... 28 7.7 At4g01380.1 68417.m00178 plastocyanin-like domain-containing pro... 28 7.7 >At2g33040.1 68415.m04052 ATP synthase gamma chain, mitochondrial (ATPC) identical to SP|Q96250 ATP synthase gamma chain, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; contains Pfam profile: PF00231 ATP synthase Length = 325 Score = 42.7 bits (96), Expect = 3e-04 Identities = 27/85 (31%), Positives = 48/85 (56%), Gaps = 2/85 (2%) Frame = +3 Query: 324 PPEDDPKQLFVAMTSDRGLCGAVHTGVSKVIR--NRLGEPGAENIKVICVGDKSRGILQR 497 P D K + V ++SD+GLCG +++ V KV R +L + ++ + VG+K++ I+ R Sbjct: 98 PSIDVKKSVVVTLSSDKGLCGGINSTVVKVSRALYKLNAGPEKEVQFVIVGEKAKAIMFR 157 Query: 498 LYGNTSLVLLMRSDVSHLLSWTQVS 572 N +VL + + L++ QVS Sbjct: 158 DSKN-DIVLSVTELNKNPLNYAQVS 181 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/22 (77%), Positives = 22/22 (100%) Frame = +1 Query: 175 RLKSVKNIQKITQSMKMVSAAK 240 R+KSVKNIQKIT++MKMV+A+K Sbjct: 51 RMKSVKNIQKITKAMKMVAASK 72 Score = 35.5 bits (78), Expect = 0.039 Identities = 20/70 (28%), Positives = 38/70 (54%) Frame = +2 Query: 503 RKHIISVANEIGRLPPTFLDASQLATAILTSGYEFGSGKIIYNKFKSVVSYAQSDLPLYT 682 + I+ E+ + P + S LA IL + EF + +I+YNKF SVV++ + + + Sbjct: 160 KNDIVLSVTELNKNPLNYAQVSVLADDILKN-VEFDALRIVYNKFHSVVAFLPTVSTVLS 218 Query: 683 KKSIESATKL 712 + IE +++ Sbjct: 219 PEIIEKESEI 228 >At4g04640.1 68417.m00679 ATP synthase gamma chain 1, chloroplast (ATPC1) identical to SP|Q01908 ATP synthase gamma chain 1, chloroplast precursor (EC 3.6.3.14) {Arabidopsis thaliana} Length = 373 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = +1 Query: 160 RAISIRLKSVKNIQKITQSMKMVSAAKYTRA 252 R + R+ SVKN QKIT++MK+V+AAK RA Sbjct: 54 RELRDRIDSVKNTQKITEAMKLVAAAKVRRA 84 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = +3 Query: 342 KQLFVAMTSDRGLCGAVHTGVSKVIRNRLGEPGAENIK--VICVGDKSRG-ILQRLY 503 K V +T DRGLCG + + K R+ E ++ VI VG K L+R Y Sbjct: 126 KVALVVVTGDRGLCGGFNNFIIKKAEARIKELKGLGLEYTVISVGKKGNSYFLRRPY 182 >At1g15700.1 68414.m01884 ATP synthase gamma chain 2, chloroplast (ATPC2) identical to SP|Q01909 ATP synthase gamma chain 2, chloroplast precursor (EC 3.6.3.14) {Arabidopsis thaliana}; contains Pfam profile: PF00231 ATP synthase; similar to ATP synthase gamma-subunit GI:21241 from [Spinacia oleracea] Length = 386 Score = 35.9 bits (79), Expect = 0.029 Identities = 16/31 (51%), Positives = 24/31 (77%) Frame = +1 Query: 160 RAISIRLKSVKNIQKITQSMKMVSAAKYTRA 252 R + R+ SVKN QKIT++M++V+AA+ RA Sbjct: 64 RELRERIDSVKNTQKITEAMRLVAAARVRRA 94 Score = 29.9 bits (64), Expect = 1.9 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = +3 Query: 354 VAMTSDRGLCGAVHTGVSKVIRNRLGEPGAENIK--VICVGDKSRGILQR 497 V +T D+GLCG + V+K R+ E I VI VG K R Sbjct: 140 VVVTGDKGLCGGFNNAVTKKATLRVQELKQRGIDCVVISVGKKGNAYFSR 189 >At1g24807.1 68414.m03108 anthranilate synthase beta subunit, putative similar to anthranilate synthase beta chain GI:403434; similar to ESTs dbj|AV540153.1, dbj|AV557490.1, gb|AI997696.1, gb|AW004516.1, dbj|AV521371.1 Length = 235 Score = 28.3 bits (60), Expect(2) = 0.68 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 454 LMFSAPGSPRRLRITLDTPVCTAPHKPLSEVIATNNCLGSSSGG 323 L+ PG+P+ I+L T + P PL V C+G + GG Sbjct: 80 LISPGPGTPQDSGISLQTVLELGPLVPLFGVCMGLQCIGEAFGG 123 Score = 21.8 bits (44), Expect(2) = 0.68 Identities = 10/48 (20%), Positives = 21/48 (43%) Frame = -2 Query: 589 ENGSGQLTCVQESRWETSDLISNTNDVFPYNLCRIPRDLSPTQITLMF 446 E+ S + S+ ++ + D F YNLC+ ++ + L + Sbjct: 3 ESNSIPSVVINSSKQNGPIIVIDNYDSFTYNLCQYKQNFENCYLFLQY 50 >At2g34990.1 68415.m04293 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097: Zinc finger, C3HC4 type (RING finger) Length = 302 Score = 31.1 bits (67), Expect = 0.83 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 4/74 (5%) Frame = +2 Query: 545 PPTFLDASQLA----TAILTSGYEFGSGKIIYNKFKSVVSYAQSDLPLYTKKSIESATKL 712 P T + AS L T IL + + G + + ++ S Y+Q + +T +ES T + Sbjct: 4 PGTEIKASDLTLLVITIILFAIFIVGLASVCF-RWTSRQFYSQESINPFTDSDVESRTSI 62 Query: 713 TAYDSLDSDVLQSY 754 TA LD ++ S+ Sbjct: 63 TAVRGLDEAIINSF 76 >At5g57890.1 68418.m07242 anthranilate synthase beta subunit, putative strong similarity to anthranilate synthase beta chain GI:403434 [Arabidopsis thaliana] Length = 273 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 454 LMFSAPGSPRRLRITLDTPVCTAPHKPLSEVIATNNCLGSSSGG 323 L+ PG+P+ I+L T + P PL V C+G + GG Sbjct: 118 LISPGPGTPQDSGISLQTVLELGPLVPLFGVCMGLQCIGEAFGG 161 >At5g19130.2 68418.m02277 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 696 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -2 Query: 511 VFPYNLCRIPRDLSPTQITLMFSAPGSPRRLRITLDTPVCT 389 + PY +C++P SPT ++M+ S L + P C+ Sbjct: 514 LLPYFICQVPGQHSPTNRSIMWGTTSSSLLLITFVTMPGCS 554 >At5g19130.1 68418.m02276 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 699 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -2 Query: 511 VFPYNLCRIPRDLSPTQITLMFSAPGSPRRLRITLDTPVCT 389 + PY +C++P SPT ++M+ S L + P C+ Sbjct: 517 LLPYFICQVPGQHSPTNRSIMWGTTSSSLLLITFVTMPGCS 557 >At2g04400.1 68415.m00444 indole-3-glycerol phosphate synthase (IGPS) nearly identical to SP|P49572 Length = 402 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -2 Query: 697 LNRLLSVEGQVGLGVRDHRLELVVNDFSGTKLVS*GENG 581 + R+L +EG +G+ + LE D S TK + GE+G Sbjct: 304 MGRVLGIEGIELVGINNRSLETFEVDISNTKKLLEGEHG 342 >At1g25220.1 68414.m03130 anthranilate synthase beta subunit (ASB1) identical to anthranilate synthase beta subunit GI:403434 from [Arabidopsis thaliana] Length = 276 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 454 LMFSAPGSPRRLRITLDTPVCTAPHKPLSEVIATNNCLGSSSGG 323 L+ PG+P+ I+L T + P PL V C+G + GG Sbjct: 121 LISPGPGTPQDSGISLQTVLELGPLVPLFGVCMGLQCIGEAFGG 164 >At1g25155.1 68414.m03123 anthranilate synthase beta subunit, putative strong similarity to anthranilate synthase beta subunit GI:403434 from (Arabidopsis thaliana) Length = 222 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 454 LMFSAPGSPRRLRITLDTPVCTAPHKPLSEVIATNNCLGSSSGG 323 L+ PG+P+ I+L T + P PL V C+G + GG Sbjct: 67 LISPGPGTPQDSGISLQTVLELGPLVPLFGVCMGLQCIGEAFGG 110 >At1g25083.1 68414.m03118 anthranilate synthase beta subunit, putative strong similarity to anthranilate synthase beta subunit GI:403434 from (Arabidopsis thaliana); similar to ESTs dbj|AV540153.1, dbj|AV557490.1, gb|AI997696.1, gb|AW004516.1, dbj|AV521371.1 Length = 222 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 454 LMFSAPGSPRRLRITLDTPVCTAPHKPLSEVIATNNCLGSSSGG 323 L+ PG+P+ I+L T + P PL V C+G + GG Sbjct: 67 LISPGPGTPQDSGISLQTVLELGPLVPLFGVCMGLQCIGEAFGG 110 >At1g24909.1 68414.m03112 anthranilate synthase beta subunit, putative strong similarity to anthranilate synthase beta subunit GI:403434 from (Arabidopsis thaliana) Length = 222 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 454 LMFSAPGSPRRLRITLDTPVCTAPHKPLSEVIATNNCLGSSSGG 323 L+ PG+P+ I+L T + P PL V C+G + GG Sbjct: 67 LISPGPGTPQDSGISLQTVLELGPLVPLFGVCMGLQCIGEAFGG 110 >At4g02350.1 68417.m00319 exocyst complex subunit Sec15-like family protein contains Pfam profile PF04091: Exocyst complex subunit Sec15-like Length = 771 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -1 Query: 476 FISHTDHLDVLSTRFAETVADHFGYTSVYSSAQTSVRGHSNKQLLG 339 F H HL + R AE HF T ++A+ ++ G K++ G Sbjct: 536 FFRHAAHLSGVPLRMAERGRRHFPLTKSQNTAEDTLSGMLKKKIDG 581 >At4g01380.1 68417.m00178 plastocyanin-like domain-containing protein Length = 210 Score = 27.9 bits (59), Expect = 7.7 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 550 YFLGRKSVGHCHSHLRIRV 606 YF+ K+ GHC++ L++RV Sbjct: 152 YFISSKTPGHCYAGLKLRV 170 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,172,775 Number of Sequences: 28952 Number of extensions: 412219 Number of successful extensions: 1067 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1014 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1067 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -