BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0563.Seq (608 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 7.1 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 7.1 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 7.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 7.1 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 7.1 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 15/79 (18%) Frame = +1 Query: 412 ALGRWQV*RSRCA*PPH--PP--------RLMRRYRARQVALSGKCAR--NPYLFIFLNT 555 A+G WQ+ C+ PP PP R R R V+ + +R P F+ +N Sbjct: 381 AMGHWQMSCVACSPPPRQTPPSRKESGRRRRRRTPRYNSVSKIDRASRIVFPLFFLAINV 440 Query: 556 ---FKYVSAHDTITLINAS 603 F Y+S + I N + Sbjct: 441 FYWFAYLSRSERINYYNVN 459 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 218 ESTFFNSGLLFQTGTTLNPI 159 E + SG L+ TT+NPI Sbjct: 307 EWLYILSGCLYYFSTTINPI 326 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -3 Query: 588 GYCIMSGYIFECI*KNKQIGVPRTF 514 G+C++ FECI + GV R + Sbjct: 452 GFCLLFLMFFECIAISWAFGVNRFY 476 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -3 Query: 588 GYCIMSGYIFECI*KNKQIGVPRTF 514 G+C++ FECI + GV R + Sbjct: 505 GFCLLFLMFFECIAISWAFGVNRFY 529 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,002 Number of Sequences: 438 Number of extensions: 3548 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -