BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0563.Seq (608 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57380.1 68418.m07169 fibronectin type III domain-containing ... 31 0.60 At3g46120.1 68416.m04991 calcineurin-like phosphoesterase family... 28 4.2 At1g52940.1 68414.m05987 calcineurin-like phosphoesterase family... 28 4.2 At4g33630.2 68417.m04778 expressed protein 28 5.6 At4g33630.1 68417.m04777 expressed protein 28 5.6 At2g18130.1 68415.m02110 purple acid phosphatase (PAP11) identic... 28 5.6 At1g03080.1 68414.m00282 kinase interacting family protein simil... 27 7.4 At3g29265.1 68416.m03673 hypothetical protein 27 9.7 At1g73290.1 68414.m08481 serine carboxypeptidase S10 family prot... 27 9.7 >At5g57380.1 68418.m07169 fibronectin type III domain-containing protein / PHD finger protein-related contains Pfam profiles PF00041: Fibronectin type III domain, PF00628: PHD-finger Length = 600 Score = 31.1 bits (67), Expect = 0.60 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +3 Query: 153 DRDRVECCSSLEQESTIKERGLQRQRAKNRLSGRGPLREP 272 D+D E CS+ E ES ++E L +++A N++ GR L P Sbjct: 434 DKDNTEHCSAGEVESELEEERLVKRKA-NKIDGRDLLVTP 472 >At3g46120.1 68416.m04991 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 388 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 202 LKNVDSNVKGRKTVYQGEAHYVNHHPN 282 L N SN KG+ ++ G+ Y + HPN Sbjct: 128 LYNYMSNPKGQAVLFAGDLSYADDHPN 154 >At1g52940.1 68414.m05987 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 396 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 202 LKNVDSNVKGRKTVYQGEAHYVNHHPN 282 L N SN KG+ ++ G+ Y + HPN Sbjct: 136 LYNYMSNPKGQAVLFAGDLSYADDHPN 162 >At4g33630.2 68417.m04778 expressed protein Length = 684 Score = 27.9 bits (59), Expect = 5.6 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 419 PSARSFRFLPFLSRHVRRLSPSSSKSGAPFRVP 321 P +++ F P S RL+PSS +S P R+P Sbjct: 7 PPSQNLAFSPAASATSSRLTPSSKRSFYPHRLP 39 >At4g33630.1 68417.m04777 expressed protein Length = 684 Score = 27.9 bits (59), Expect = 5.6 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 419 PSARSFRFLPFLSRHVRRLSPSSSKSGAPFRVP 321 P +++ F P S RL+PSS +S P R+P Sbjct: 7 PPSQNLAFSPAASATSSRLTPSSKRSFYPHRLP 39 >At2g18130.1 68415.m02110 purple acid phosphatase (PAP11) identical to purple acid phosphatase (PAP11) GI:20257484 from [Arabidopsis thaliana] Length = 441 Score = 27.9 bits (59), Expect = 5.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 202 LKNVDSNVKGRKTVYQGEAHYVNHHPN 282 L N SN KG+ ++ G+ Y + HPN Sbjct: 156 LYNYMSNPKGQAVLFVGDLSYADDHPN 182 >At1g03080.1 68414.m00282 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1744 Score = 27.5 bits (58), Expect = 7.4 Identities = 9/32 (28%), Positives = 21/32 (65%) Frame = +3 Query: 141 IKRIDRDRVECCSSLEQESTIKERGLQRQRAK 236 ++ + + VE C +LE ST+K+R +++ + + Sbjct: 1340 LEGLTNELVEACKNLESRSTLKDREIEQLKGR 1371 >At3g29265.1 68416.m03673 hypothetical protein Length = 236 Score = 27.1 bits (57), Expect = 9.7 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 187 NKSPLLKNVDSNVKGRKTVYQGEAHYVNH--HPNQVFWGRGA 306 N L+KN S G K + A V + N++FWGRGA Sbjct: 118 NSELLIKNHMSRPTGSKAFPEVNALDVKNPLRENKIFWGRGA 159 >At1g73290.1 68414.m08481 serine carboxypeptidase S10 family protein similar to serine carboxypeptidase I precursor (SP:P07519) [Hordeum vulgare]; glucose acyltransferase GB:AAD01263 [Solanum berthaultii]; contains Pfam profile: PF00450 Serine carboxypeptidase; Length = 438 Score = 27.1 bits (57), Expect = 9.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 200 SGLLFQTGTTLNPISVYSFDL*GILPISAYWLK 102 SGLLF+ G + VY+ L ++P + W K Sbjct: 91 SGLLFENGPLAMKLDVYNGTLPSLVPTTYSWTK 123 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,299,185 Number of Sequences: 28952 Number of extensions: 242458 Number of successful extensions: 514 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1216725696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -