BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0556.Seq (679 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 2.3 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 2.3 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 2.3 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 23 2.3 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 2.3 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 2.3 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 2.3 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 2.3 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 2.3 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 22 4.0 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 22 4.0 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 22 4.0 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 22 5.3 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 21 7.0 DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 21 9.3 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 483 VDGVEWCYGLSAGHHRASPVDQSCSVGANST 391 V+ + CYG A ++SP + ANST Sbjct: 7 VNSLAQCYGQQARDQQSSPGTDYYNPNANST 37 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 483 VDGVEWCYGLSAGHHRASPVDQSCSVGANST 391 V+ + CYG A ++SP + ANST Sbjct: 7 VNSLAQCYGQQARDQQSSPGTDYYNPNANST 37 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 483 VDGVEWCYGLSAGHHRASPVDQSCSVGANST 391 V+ + CYG A ++SP + ANST Sbjct: 7 VNSLAQCYGQQARDQQSSPGTDYYNPNANST 37 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 23.0 bits (47), Expect = 2.3 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 188 IYRPTSRSVTRLVTYPDVPHHVGESGSAHPWCSVSWTESLTVAVQH 325 +Y T SVT VTY P ES + CS+ + +T+ V + Sbjct: 137 LYIFTYLSVTCYVTYAWSPIDHTESNIINDMCSLYYILQITLIVNY 182 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 483 VDGVEWCYGLSAGHHRASPVDQSCSVGANST 391 V+ + CYG A ++SP + ANST Sbjct: 7 VNSLAQCYGQQARDQQSSPGTDYYNPNANST 37 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 483 VDGVEWCYGLSAGHHRASPVDQSCSVGANST 391 V+ + CYG A ++SP + ANST Sbjct: 7 VNSLAQCYGQQARDQQSSPGTDYYNPNANST 37 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 483 VDGVEWCYGLSAGHHRASPVDQSCSVGANST 391 V+ + CYG A ++SP + ANST Sbjct: 7 VNSLAQCYGQQARDQQSSPGTDYYNPNANST 37 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 483 VDGVEWCYGLSAGHHRASPVDQSCSVGANST 391 V+ + CYG A ++SP + ANST Sbjct: 7 VNSLAQCYGQQARDQQSSPGTDYYNPNANST 37 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 483 VDGVEWCYGLSAGHHRASPVDQSCSVGANST 391 V+ + CYG A ++SP + ANST Sbjct: 7 VNSLAQCYGQQARDQQSSPGTDYYNPNANST 37 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 374 LSKMRPVEFAPTLQL*STGLALW 442 L++ R +E A LQL T + +W Sbjct: 278 LTRARRIEIASALQLNETQVKIW 300 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 374 LSKMRPVEFAPTLQL*STGLALW 442 L++ R +E A LQL T + +W Sbjct: 67 LTRARRIEIASALQLNETQVKIW 89 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 374 LSKMRPVEFAPTLQL*STGLALW 442 L++ R +E A LQL T + +W Sbjct: 67 LTRARRIEIASALQLNETQVKIW 89 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 411 SVGANSTGLIFESLGCFGAQEVIDG 337 S G N G I SLG G++ V G Sbjct: 213 SFGTNLVGGIVRSLGTLGSRVVESG 237 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 21.4 bits (43), Expect = 7.0 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = -3 Query: 584 IVDAIRDAA*GHQKLSNVSVIAETVRIGSPYEYE*MVSSGATD 456 I+DA++ H KL ++ TV+ + + S ATD Sbjct: 61 ILDAMKKDPARHSKLEKADILEMTVKHLQNLQRQQAAMSAATD 103 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 21.0 bits (42), Expect = 9.3 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -3 Query: 161 RNRCTGYDSTGAETIGSTLKTEASRCRWTCRAD 63 + RCT TI L T+ ++C +A+ Sbjct: 48 KGRCTPEGKKLKSTIPEALSTDCAKCNEKVKAN 80 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,623 Number of Sequences: 336 Number of extensions: 3252 Number of successful extensions: 28 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -