BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0553.Seq (784 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 29 0.042 AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-... 23 2.8 AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-... 23 2.8 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 6.4 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 29.1 bits (62), Expect = 0.042 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -2 Query: 270 EMPVRSNSPTVAAAPAVPYRPSRKYPHRTLPMYS 169 ++ V + PAVPY P +Y +R P+Y+ Sbjct: 234 QLEVNERKENLTCQPAVPYVPFYRYCYRPYPVYN 267 >AY600516-1|AAT11864.1| 143|Tribolium castaneum optomotor-blind-like protein protein. Length = 143 Score = 23.0 bits (47), Expect = 2.8 Identities = 15/46 (32%), Positives = 19/46 (41%) Frame = -2 Query: 252 NSPTVAAAPAVPYRPSRKYPHRTLPMYSSTNFKYL*STITLRLLNN 115 NS + A A P P R Y H P + + S L+L NN Sbjct: 37 NSRWMVAGKADPEMPKRMYIHPDSPSTGEQWMQKVVSFHKLKLTNN 82 >AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-like protein protein. Length = 134 Score = 23.0 bits (47), Expect = 2.8 Identities = 15/46 (32%), Positives = 19/46 (41%) Frame = -2 Query: 252 NSPTVAAAPAVPYRPSRKYPHRTLPMYSSTNFKYL*STITLRLLNN 115 NS + A A P P R Y H P + + S L+L NN Sbjct: 37 NSRWMVAGKADPEMPKRMYIHPDSPSTGEQWMQKVVSFHKLKLTNN 82 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 6.4 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +3 Query: 180 VVYGVDIFVRVGTGRPVPPL 239 +V G+++ ++VGT +PP+ Sbjct: 677 IVIGMNLVLQVGTHADLPPV 696 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,579 Number of Sequences: 336 Number of extensions: 2854 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21168876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -