BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0553.Seq (784 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4A8.06c |||esterase/lipase |Schizosaccharomyces pombe|chr 1|... 27 2.3 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 25 9.3 >SPAC4A8.06c |||esterase/lipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 578 Score = 27.5 bits (58), Expect = 2.3 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = -2 Query: 246 PTVAAAPAVPYRPSRKYPHRTLPMYSSTNFKYL*STITLRLLNNY 112 P+V A A Y PS + HR + TN STI+ + L NY Sbjct: 252 PSVVADDAADYIPSEGFHHRASRYWPITNLDSF-STISEKELLNY 295 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 25.4 bits (53), Expect = 9.3 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -2 Query: 282 PRDHEMPVRSNSPTVAAAPAVPYRPS 205 P P R +P V AP+VP RP+ Sbjct: 539 PEVPSAPQRPAAPVVPEAPSVPQRPA 564 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,620,568 Number of Sequences: 5004 Number of extensions: 44745 Number of successful extensions: 105 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -