BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0553.Seq (784 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 5.6 SB_36683| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_42688| Best HMM Match : PB1 (HMM E-Value=0.12) 28 9.8 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 28.7 bits (61), Expect = 5.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 94 SVSCGRRCGGGPTARGTYTQWGK 26 S+ C GPTA +Y+ WG+ Sbjct: 1360 SMQANNECRSGPTAHSSYSAWGR 1382 >SB_36683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 581 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +2 Query: 128 RNVIVDHKYLKFVEEYIGSVRCGYFREGRYGTAGAAAT 241 RN ++ KY K VEEYI E Y G++ T Sbjct: 371 RNPVLHQKYSKTVEEYIDPGHAERISEDSYPVPGSSLT 408 >SB_42688| Best HMM Match : PB1 (HMM E-Value=0.12) Length = 1338 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = -2 Query: 342 LPIRYNRFDLV*RASGRLGVPRDHEMPVRSNSPTVAAAPAVPYRPSRKYPHRTLPMY 172 +PI + ++ A + RD P S PTV + +P P+R P T P + Sbjct: 1140 MPIASGQVNMSDDAPAGFAMERDQATPPISTQPTVGSDEVIPAPPTRS-PVNTAPSH 1195 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,051,271 Number of Sequences: 59808 Number of extensions: 318724 Number of successful extensions: 809 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 807 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2143884611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -