BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0553.Seq (784 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-... 23 3.2 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.2 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 4.2 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 9.8 >M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H17. ). Length = 79 Score = 23.0 bits (47), Expect = 3.2 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 202 KISTPYTTYVLFNKLQVFMINDYITITE 119 K TP+TT L + + F Y+TI E Sbjct: 11 KPRTPFTTQQLLSLEKKFREKQYLTIAE 38 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 3.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 57 VGPPPHRRPQLTLVSCQTNNYSVIV 131 V PPH PQ+TL + TN+ ++ V Sbjct: 1363 VHAPPHS-PQITLTATTTNSLTMKV 1386 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.6 bits (46), Expect = 4.2 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = -2 Query: 318 DLV*RASGRLGVPRDHEMP----VRSNSPTVAAAPAVPYRPSRKYPHRTLP 178 D+V + +G+ D EMP + NS T+ P Y P +Y H P Sbjct: 119 DIVMHSVTSVGI--DLEMPSVECIVFNSGTILCVPFTTYTPVCEYDHTWWP 167 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +2 Query: 569 LNKYKNIVMISVNRGHGIVLCILNYLYK 652 L KY MI V I +C+LN ++ Sbjct: 312 LGKYLLFTMILVTLSIWITVCVLNVHFR 339 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,122 Number of Sequences: 438 Number of extensions: 3530 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -