BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0551.Seq (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 25 1.7 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 24 5.0 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 6.7 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 8.8 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 25.4 bits (53), Expect = 1.7 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +3 Query: 78 EVKSTAKTQRISAHSHIKGLGLDENGVPIQMAAGLVGQESARE 206 E+K ++ Q+ S G G G P AAG VG S + Sbjct: 308 EIKHSSLYQQTSRQHGTGGQGSSVGGAPTGAAAGSVGTASGEQ 350 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 23.8 bits (49), Expect = 5.0 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +3 Query: 66 MKIEEVKSTAKTQRISAHSHIKGLG-LDENGVPIQMAAGLVGQESARE 206 ++ E+ + ++ ++ IK G LD VPI+ AAGL E A + Sbjct: 257 VEYREMNNVQRSDFMNLLLQIKNTGSLDGGDVPIKGAAGLTMNELAAQ 304 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.4 bits (48), Expect = 6.7 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -2 Query: 510 APAGFSVSTGVNSVTSPSYTSLVSRI 433 AP G S + GV S SP Y S S + Sbjct: 88 APQGRSAAEGVPSSASPVYMSPASSL 113 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 327 PSS*AMARAIAVLPVPGGPAKSKAP 253 PS+ AMA I PV P+ + AP Sbjct: 927 PSTSAMAATIVPNPVQASPSPATAP 951 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 673,056 Number of Sequences: 2352 Number of extensions: 14455 Number of successful extensions: 23 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -