BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0549.Seq (741 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04640.1 68417.m00679 ATP synthase gamma chain 1, chloroplast... 49 4e-06 At2g33040.1 68415.m04052 ATP synthase gamma chain, mitochondrial... 44 1e-04 At1g15700.1 68414.m01884 ATP synthase gamma chain 2, chloroplast... 43 2e-04 At1g13530.1 68414.m01586 expressed protein ; expression support... 31 0.61 At5g24550.1 68418.m02899 glycosyl hydrolase family 1 protein con... 30 1.9 At2g36670.2 68415.m04498 aspartyl protease family protein contai... 30 1.9 At2g36670.1 68415.m04497 aspartyl protease family protein contai... 30 1.9 At5g19130.2 68418.m02277 GPI transamidase component family prote... 29 4.3 At5g19130.1 68418.m02276 GPI transamidase component family prote... 29 4.3 At3g60140.1 68416.m06715 glycosyl hydrolase family 1 protein con... 28 5.7 At4g23060.1 68417.m03325 calmodulin-binding family protein conta... 28 7.5 At4g02350.1 68417.m00319 exocyst complex subunit Sec15-like fami... 28 7.5 At3g21200.1 68416.m02679 expressed protein 28 7.5 At4g03620.1 68417.m00497 myosin heavy chain-related contains wea... 27 9.9 At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-rel... 27 9.9 At2g04400.1 68415.m00444 indole-3-glycerol phosphate synthase (I... 27 9.9 At1g13940.1 68414.m01637 expressed protein 27 9.9 >At4g04640.1 68417.m00679 ATP synthase gamma chain 1, chloroplast (ATPC1) identical to SP|Q01908 ATP synthase gamma chain 1, chloroplast precursor (EC 3.6.3.14) {Arabidopsis thaliana} Length = 373 Score = 48.8 bits (111), Expect = 4e-06 Identities = 23/50 (46%), Positives = 35/50 (70%) Frame = +2 Query: 95 ATLKAISIRLXSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQ 244 A+L+ + R+ SVKN QKIT++MK+V+AAK RA+ + RP+ E V+ Sbjct: 51 ASLRELRDRIDSVKNTQKITEAMKLVAAAKVRRAQEAVVNGRPFSETLVE 100 Score = 29.9 bits (64), Expect = 1.9 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = +1 Query: 286 KQLFVAMTSDRGLCGAVHTGVSKVIRNRLSEPGAENIK--VICVGDKSRG-ILQRLY 447 K V +T DRGLCG + + K R+ E ++ VI VG K L+R Y Sbjct: 126 KVALVVVTGDRGLCGGFNNFIIKKAEARIKELKGLGLEYTVISVGKKGNSYFLRRPY 182 >At2g33040.1 68415.m04052 ATP synthase gamma chain, mitochondrial (ATPC) identical to SP|Q96250 ATP synthase gamma chain, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; contains Pfam profile: PF00231 ATP synthase Length = 325 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 2/77 (2%) Frame = +1 Query: 268 PPEDDPKQLFVAMTSDRGLCGAVHTGVSKVIR--NRLSEPGAENIKVICVGDKSRGILQR 441 P D K + V ++SD+GLCG +++ V KV R +L+ + ++ + VG+K++ I+ R Sbjct: 98 PSIDVKKSVVVTLSSDKGLCGGINSTVVKVSRALYKLNAGPEKEVQFVIVGEKAKAIMFR 157 Query: 442 LYGKHIISVANEIGRLP 492 I+ E+ + P Sbjct: 158 DSKNDIVLSVTELNKNP 174 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/33 (54%), Positives = 28/33 (84%) Frame = +2 Query: 86 RNMATLKAISIRLXSVKNIQKITQSMKMVSAAK 184 R+++T + + R+ SVKNIQKIT++MKMV+A+K Sbjct: 41 RSIST-QVVRNRMKSVKNIQKITKAMKMVAASK 72 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/52 (34%), Positives = 30/52 (57%) Frame = +3 Query: 486 SPTYFLGRSQLATAILTSGYEFGSGKIIYNKFKSVVSYAQSDLPLYTKKSIE 641 +P + S LA IL + EF + +I+YNKF SVV++ + + + + IE Sbjct: 173 NPLNYAQVSVLADDILKN-VEFDALRIVYNKFHSVVAFLPTVSTVLSPEIIE 223 >At1g15700.1 68414.m01884 ATP synthase gamma chain 2, chloroplast (ATPC2) identical to SP|Q01909 ATP synthase gamma chain 2, chloroplast precursor (EC 3.6.3.14) {Arabidopsis thaliana}; contains Pfam profile: PF00231 ATP synthase; similar to ATP synthase gamma-subunit GI:21241 from [Spinacia oleracea] Length = 386 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/50 (40%), Positives = 34/50 (68%) Frame = +2 Query: 95 ATLKAISIRLXSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQ 244 A ++ + R+ SVKN QKIT++M++V+AA+ RA+ + RP+ E V+ Sbjct: 61 AGIRELRERIDSVKNTQKITEAMRLVAAARVRRAQDAVIKGRPFTETLVE 110 Score = 30.7 bits (66), Expect = 1.1 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = +1 Query: 298 VAMTSDRGLCGAVHTGVSKVIRNRLSEPGAENIK--VICVGDKSRGILQR 441 V +T D+GLCG + V+K R+ E I VI VG K R Sbjct: 140 VVVTGDKGLCGGFNNAVTKKATLRVQELKQRGIDCVVISVGKKGNAYFSR 189 >At1g13530.1 68414.m01586 expressed protein ; expression supported by MPSS Length = 385 Score = 31.5 bits (68), Expect = 0.61 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 487 LPPTFLDEVSWPLPFS-PQDTSLVPERSFITSSSLWYRTP 603 +PP FL W +PFS QD L+ + + + L Y P Sbjct: 167 IPPRFLRRKGWTVPFSASQDYGLIDDAKGVVDAKLRYELP 206 >At5g24550.1 68418.m02899 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to anther-specific protein ATA27 (GI:2746341) [Arabidopsis thaliana] Length = 534 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -1 Query: 489 ETSNLISNTNDVLSVQSLQDTARFISHTDHLDVLSTRFAETVADHFRY 346 E S ++ N+ D + + TARF++H H+D+ RF T H +Y Sbjct: 327 EQSMMLQNSFDFIGINYY--TARFVAHDLHVDLSRPRF--TTDQHLQY 370 >At2g36670.2 68415.m04498 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 507 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = -2 Query: 392 FSAPGSLRRLRITLDTPVCTAPHKPLSEVIATNNCLGSS----SGGVTSAFHRT 243 F APGSL +T P+C++ + + + NN G S G TS ++ T Sbjct: 147 FDAPGSLTAGSVTCSDPICSSVFQTTAAQCSENNQCGYSFRYGDGSGTSGYYMT 200 >At2g36670.1 68415.m04497 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 512 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = -2 Query: 392 FSAPGSLRRLRITLDTPVCTAPHKPLSEVIATNNCLGSS----SGGVTSAFHRT 243 F APGSL +T P+C++ + + + NN G S G TS ++ T Sbjct: 152 FDAPGSLTAGSVTCSDPICSSVFQTTAAQCSENNQCGYSFRYGDGSGTSGYYMT 205 >At5g19130.2 68418.m02277 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 696 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -2 Query: 473 LATLMMCFPYNLCRIPRDLSPTQITLMFSAPGSLRRLRITLDTPVCT 333 L ++ PY +C++P SPT ++M+ S L + P C+ Sbjct: 508 LGFIVTLLPYFICQVPGQHSPTNRSIMWGTTSSSLLLITFVTMPGCS 554 >At5g19130.1 68418.m02276 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 699 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -2 Query: 473 LATLMMCFPYNLCRIPRDLSPTQITLMFSAPGSLRRLRITLDTPVCT 333 L ++ PY +C++P SPT ++M+ S L + P C+ Sbjct: 511 LGFIVTLLPYFICQVPGQHSPTNRSIMWGTTSSSLLLITFVTMPGCS 557 >At3g60140.1 68416.m06715 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to Cyanogenic Beta-Glucosidase (GI:1311386)(pdb:1CBG) [Trifolium Repens]; identical beta-glucosidase GI:10834547 Length = 577 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 489 ETSNLISNTNDVLSVQSLQDTARFISHTDHLDVLSTRF 376 E S ++ N++D + + TARF +H H+D RF Sbjct: 321 EQSKMLQNSSDFVGINYY--TARFAAHLPHIDPEKPRF 356 >At4g23060.1 68417.m03325 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 543 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = -2 Query: 596 RYHRLELVINDLSGTKLVS*GENGSGQLTSSKKVGGRRPISLATLMMCFPYNL 438 R H L + T+++ E+ S Q ++K + P+SL M P+NL Sbjct: 214 RMHALVRAQARVRATRVIVTPESSSSQSNNTKSSHFQNPVSLVKFPMIVPFNL 266 >At4g02350.1 68417.m00319 exocyst complex subunit Sec15-like family protein contains Pfam profile PF04091: Exocyst complex subunit Sec15-like Length = 771 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -1 Query: 420 FISHTDHLDVLSTRFAETVADHFRYTSVYSSAQTSVRGHSNKQLLG 283 F H HL + R AE HF T ++A+ ++ G K++ G Sbjct: 536 FFRHAAHLSGVPLRMAERGRRHFPLTKSQNTAEDTLSGMLKKKIDG 581 >At3g21200.1 68416.m02679 expressed protein Length = 317 Score = 27.9 bits (59), Expect = 7.5 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 389 SAPGSLR-RLRITLDTPVCTAPHKPLSEVIATNNCLGSSSGGVTSAFH 249 S P SLR + TLDTP + HKP ++ + SS G +++ H Sbjct: 35 SRPISLRCSVSTTLDTPATASTHKPFPAEVSRSIMELSSVGTLSTLTH 82 >At4g03620.1 68417.m00497 myosin heavy chain-related contains weak similarity to Swiss-Prot:P24733 myosin heavy chain, striated muscle [Aequipecten irradians] Length = 342 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -2 Query: 281 SSSGGVTSAFHRTVLHLHHRDEQLSG 204 S SG +TS+ RT+ H H D L G Sbjct: 47 SDSGSITSSPTRTIEHQSHEDSGLEG 72 >At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-related contains Pfam PF02138: Beige/BEACH domain; contains Pfam PF00400: WD domain, G-beta repeat (3 copies) Length = 2946 Score = 27.5 bits (58), Expect = 9.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 683 RRCPESRMPSACGALNRLLSVEGQVGLGVRYHRLE 579 R CP++ + A G L R V GQV + R +E Sbjct: 640 RFCPDASLSGAAGTLRRPAEVLGQVHVATRMKPVE 674 >At2g04400.1 68415.m00444 indole-3-glycerol phosphate synthase (IGPS) nearly identical to SP|P49572 Length = 402 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -2 Query: 641 LNRLLSVEGQVGLGVRYHRLELVINDLSGTKLVS*GENG 525 + R+L +EG +G+ LE D+S TK + GE+G Sbjct: 304 MGRVLGIEGIELVGINNRSLETFEVDISNTKKLLEGEHG 342 >At1g13940.1 68414.m01637 expressed protein Length = 1005 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 263 TSAFHRTVLHLHHRDEQLSGHAQHGCI*QLTPSS 162 T++ H V+H +H D L+ H Q + P S Sbjct: 383 TNSSHEAVIHQNHLDSSLTSHQQRPLYPYIRPDS 416 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,497,930 Number of Sequences: 28952 Number of extensions: 395328 Number of successful extensions: 1143 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1093 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1143 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -