BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0548.Seq (783 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 3.2 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 3.2 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 3.2 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 4.2 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 7.4 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 9.8 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 9.8 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.0 bits (47), Expect = 3.2 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 625 LFLFQYY*SI-YQGYCLMSGYIFECI*KNKQIGVPRTF 515 +++FQ S G+CL+ FECI + GV R + Sbjct: 439 MYVFQLLDSYAVSGFCLLFLMFFECIAISWAFGVNRFY 476 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.0 bits (47), Expect = 3.2 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 625 LFLFQYY*SI-YQGYCLMSGYIFECI*KNKQIGVPRTF 515 +++FQ S G+CL+ FECI + GV R + Sbjct: 492 MYVFQLLDSYAVSGFCLLFLMFFECIAISWAFGVNRFY 529 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.0 bits (47), Expect = 3.2 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +2 Query: 536 LFIFLNTFKYVSAHETITLINASIILKKEEYEYSTF 643 LF+ L+ F V ETI +N++ + + Y ++ Sbjct: 605 LFLLLDMFNCVVVEETIPSLNSTNVTLSTKCPYPSY 640 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.6 bits (46), Expect = 4.2 Identities = 23/79 (29%), Positives = 33/79 (41%), Gaps = 15/79 (18%) Frame = +2 Query: 413 ALGRWQV*RSRCA*PPH--PP--------RLMRRYRARQVALSGKCAR--NPYLFIFLNT 556 A+G WQ+ C+ PP PP R R R V+ + +R P F+ +N Sbjct: 381 AMGHWQMSCVACSPPPRQTPPSRKESGRRRRRRTPRYNSVSKIDRASRIVFPLFFLAINV 440 Query: 557 ---FKYVSAHETITLINAS 604 F Y+S E I N + Sbjct: 441 FYWFAYLSRSERINYYNVN 459 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.8 bits (44), Expect = 7.4 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +3 Query: 678 CLPVFAHPETLVKVKDAEDQL 740 C P HPET++ V L Sbjct: 364 CSPQTVHPETIIDVSRRRSSL 384 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 219 ESTFFNSGLLFQTGTTLNPI 160 E + SG L+ TT+NPI Sbjct: 307 EWLYILSGCLYYFSTTINPI 326 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -1 Query: 45 ICHSPFSVRNCWEG 4 IC PF V N W G Sbjct: 346 ICWLPFFVVNLWSG 359 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,157 Number of Sequences: 438 Number of extensions: 4679 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -