BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0547.Seq (759 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z80223-8|CAN99671.1| 177|Caenorhabditis elegans Hypothetical pr... 29 3.6 Z80223-7|CAB02316.2| 613|Caenorhabditis elegans Hypothetical pr... 29 3.6 >Z80223-8|CAN99671.1| 177|Caenorhabditis elegans Hypothetical protein F26D10.9b protein. Length = 177 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 330 DFDIEPAFFRTPAHRDMLRKRVSITADACTD 422 DF IEPA P+++D+L +S+ TD Sbjct: 121 DFSIEPASKLIPSNKDLLNAEISVVTANVTD 151 >Z80223-7|CAB02316.2| 613|Caenorhabditis elegans Hypothetical protein F26D10.9a protein. Length = 613 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 330 DFDIEPAFFRTPAHRDMLRKRVSITADACTD 422 DF IEPA P+++D+L +S+ TD Sbjct: 557 DFSIEPASKLIPSNKDLLNAEISVVTANVTD 587 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,848,395 Number of Sequences: 27780 Number of extensions: 347510 Number of successful extensions: 824 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 783 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 824 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1809061256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -