BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0543.Seq (701 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0578 + 5180538-5181385,5182480-5182595,5183397-5183605,518... 31 0.67 04_04_0158 - 23187070-23187264,23187347-23187477,23187550-231877... 29 4.7 >05_01_0578 + 5180538-5181385,5182480-5182595,5183397-5183605, 5184024-5184143,5184247-5184375,5184466-5184591, 5185550-5185667,5186471-5186680,5186788-5187100, 5187467-5187560,5187760-5187868,5188322-5188593, 5188684-5188811,5188977-5189211,5189794-5189982, 5190069-5190349,5190431-5190698,5190719-5190961, 5191598-5191680,5192484-5192493 Length = 1366 Score = 31.5 bits (68), Expect = 0.67 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +2 Query: 8 VVGEEAPKVLHKQFNSPINLYSEQNIANSIRQQTSPLPTN 127 V G++ PK L+ F L + +NI S++ SP PTN Sbjct: 746 VTGKDCPKGLYGTFCKACPLGTYKNITGSLKSLCSPCPTN 785 >04_04_0158 - 23187070-23187264,23187347-23187477,23187550-23187763, 23187834-23187932,23188034-23188156,23188247-23188366, 23188447-23188506,23188592-23188884,23189554-23189707, 23189813-23190130,23190668-23190798,23191001-23191586, 23192125-23192739 Length = 1012 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/88 (19%), Positives = 39/88 (44%) Frame = +3 Query: 9 WLAKRHLRCCTSNSTLQSIYTRNRTLQTLSGSKLRLCQLTAITDGRTLSRGKSFTRNATM 188 W + ++ ++ + RTL+ SG L + + + RGK++ R +T+ Sbjct: 618 WKYRELVKIICKEHNIKDVEYAARTLEAESGGILVAVERVSKAHAIIIYRGKNYQRPSTL 677 Query: 189 QQSTHILIDALMLLSIYYAIFRSCKLFI 272 + + + + S+ Y ++S KL + Sbjct: 678 RPKSLLNKKDALKRSVEYQRYKSLKLHV 705 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,425,682 Number of Sequences: 37544 Number of extensions: 275906 Number of successful extensions: 560 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 560 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -