BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0540.Seq (579 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G10.09 |||glucosidase I Gls1 |Schizosaccharomyces pombe|chr... 27 2.0 SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytoch... 26 3.5 SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion ... 26 3.5 SPBC651.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 25 6.1 SPBC27B12.08 |||AP-1 accessory protein |Schizosaccharomyces pomb... 25 8.0 >SPAC6G10.09 |||glucosidase I Gls1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 808 Score = 27.1 bits (57), Expect = 2.0 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 67 ELATKWVRSNFEVWKQKAAMLEKYDAT 147 EL T V + FE W+Q E+YD T Sbjct: 757 ELRTNVVNNVFENWRQTGIFWEQYDPT 783 >SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytochrome c oxidase assembly protein Cox1101, mitochondrial ribosomal protein Rsm22|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 26.2 bits (55), Expect = 3.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 143 ASYFSSMAAFCFQTSKL 93 A YFS +A FCF+ KL Sbjct: 685 AVYFSKVACFCFEEQKL 701 >SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion cytochrome c oxidase assembly protein Cox1102, mitochondrial ribosomal protein Rsm2202|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 26.2 bits (55), Expect = 3.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 143 ASYFSSMAAFCFQTSKL 93 A YFS +A FCF+ KL Sbjct: 685 AVYFSKVACFCFEEQKL 701 >SPBC651.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 237 Score = 25.4 bits (53), Expect = 6.1 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 160 ARPESWRRTSPAWRPSASRLQ 98 A PE W + SP W+ R Q Sbjct: 13 ASPEQWEKWSPRWKSIVFRTQ 33 >SPBC27B12.08 |||AP-1 accessory protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1919 Score = 25.0 bits (52), Expect = 8.0 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 465 FI*YCYNTSLDFSNII-LIVHGNFFSLSVAICEKIV 569 F+ C+N LD SNI IV + F+ ++ + E I+ Sbjct: 1649 FVILCFNAFLDVSNIFPAIVRVDLFATAMHVYEVIM 1684 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,956,407 Number of Sequences: 5004 Number of extensions: 29712 Number of successful extensions: 75 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 248115846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -