BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0540.Seq (579 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24040.1 68417.m03454 glycosyl hydrolase family protein 37 / ... 71 6e-13 >At4g24040.1 68417.m03454 glycosyl hydrolase family protein 37 / trehalase, putative similar to trehalase 1 GMTRE1 GI:4559292 from [Glycine max] Length = 626 Score = 70.9 bits (166), Expect = 6e-13 Identities = 30/80 (37%), Positives = 47/80 (58%) Frame = +1 Query: 4 QYIVIMGLANTGHPEAMRYATELATKWVRSNFEVWKQKAAMLEKYDATIXXXXXXXXEYV 183 Q +++ GL + EA A ++A +W++SN+ V+K+ + EK T EY+ Sbjct: 538 QEMIVTGLGRSSVKEAKEMAEDIARRWIKSNYLVYKKSGTIHEKLKVTELGEYGGGGEYM 597 Query: 184 VQTGFGWSNGVVMSLLNRYG 243 QTGFGWSNGV+++ L YG Sbjct: 598 PQTGFGWSNGVILAFLEEYG 617 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,247,352 Number of Sequences: 28952 Number of extensions: 157147 Number of successful extensions: 372 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 372 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -