BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0539.Seq (663 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 2.0 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 22 6.0 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 6.0 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 6.0 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 7.9 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 524 GPGFVLPHAAAERGDLAHRRDALDPALRVPLP 619 GP L AAA + LA R+ + +PLP Sbjct: 197 GPSKKLAKAAASKAALAKLRNVHSSSFCIPLP 228 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/45 (24%), Positives = 17/45 (37%) Frame = -2 Query: 470 HMPHRPCSKVSMITKTMFPLFLTPNTDIMKMSTSAVCPHITTNWV 336 H PCS L L N I+ ++ S ++T W+ Sbjct: 78 HWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWI 122 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/45 (24%), Positives = 17/45 (37%) Frame = -2 Query: 470 HMPHRPCSKVSMITKTMFPLFLTPNTDIMKMSTSAVCPHITTNWV 336 H PCS L L N I+ ++ S ++T W+ Sbjct: 78 HWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWI 122 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/45 (24%), Positives = 17/45 (37%) Frame = -2 Query: 470 HMPHRPCSKVSMITKTMFPLFLTPNTDIMKMSTSAVCPHITTNWV 336 H PCS L L N I+ ++ S ++T W+ Sbjct: 78 HWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWI 122 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/54 (18%), Positives = 19/54 (35%) Frame = -1 Query: 447 QSQHDNEDDVPIILDAEHRYHEDEHQRRLSAHHHELGDDVREQDLSGRHSRHPG 286 Q H P + + ++ Q+ L AH + ++Q + PG Sbjct: 167 QMHHQMHTQHPHMQPQQGQHQSQAQQQHLQAHEQHMMYQQQQQSQAASQQSQPG 220 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,341 Number of Sequences: 438 Number of extensions: 4102 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -