BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0537.Seq (720 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 23 1.9 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 22 4.4 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 23.4 bits (48), Expect = 1.9 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -3 Query: 499 FLTRPVKASVRSVPWPANRIRKIHAPCSLNTFSNAPKAPFRN 374 F R VK +P A + + C L T S+A + F N Sbjct: 165 FQNRRVKYKKEDLPAAAGKASNGNKCCCLRTCSSAKRPKFEN 206 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 707 PPSLRCAHAGRKPNHR 660 PP +RCA KPN + Sbjct: 102 PPIVRCALRKHKPNRK 117 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,665 Number of Sequences: 336 Number of extensions: 3424 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -