BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0537.Seq (720 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_8913| Best HMM Match : Linker_histone (HMM E-Value=0.61) 28 8.8 >SB_25386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 695 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -1 Query: 390 KHLLET*RLPNMEQEVACGADVVLPLARLRKLFPLS 283 +H + ++P+ EQEV G D+ P+A+ K+ P S Sbjct: 314 EHEVHDQKVPSYEQEVPTGEDIREPVAKRLKMEPSS 349 >SB_8913| Best HMM Match : Linker_histone (HMM E-Value=0.61) Length = 297 Score = 27.9 bits (59), Expect = 8.8 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = +1 Query: 157 RTFKISVSLKYKAGFVRTYGGAGVLFREYVRQWLSELILGFHR 285 R+FK ++S + AG+ RT+ GAG + R +W+SE I R Sbjct: 62 RSFKGAISYRNSAGWNRTH-GAGKVSR--AGRWVSEAIRALDR 101 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,817,980 Number of Sequences: 59808 Number of extensions: 472351 Number of successful extensions: 1074 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1000 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1072 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -