BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0536.Seq (722 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 129 3e-32 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 129 3e-32 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 95 4e-22 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 27 0.15 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 4.4 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 22 5.8 DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 21 7.6 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 129 bits (311), Expect = 3e-32 Identities = 59/83 (71%), Positives = 75/83 (90%) Frame = +3 Query: 6 CERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKM 185 CERAKRTLSS+TQASIEIDSLF+GID+ T+ITRARFE++N D F+ ++PV+K L+DAK+ Sbjct: 95 CERAKRTLSSATQASIEIDSLFDGIDYSTTITRARFEDINMDYFKKCIDPVDKVLQDAKI 154 Query: 186 DKAQIHDIVLVGGSTRIPKVQKL 254 K+ +H+IVLVGGSTRIPKVQ+L Sbjct: 155 GKSAVHEIVLVGGSTRIPKVQQL 177 Score = 31.1 bits (67), Expect = 0.009 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +2 Query: 236 PQGAEALQDFFNGKELNKSINPDE 307 P+ + + ++FNGKE +SINPDE Sbjct: 172 PKVQQLITEYFNGKEPCRSINPDE 195 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 129 bits (311), Expect = 3e-32 Identities = 59/83 (71%), Positives = 75/83 (90%) Frame = +3 Query: 6 CERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKM 185 CERAKRTLSS+TQASIEIDSLF+GID+ T+ITRARFE++N D F+ ++PV+K L+DAK+ Sbjct: 95 CERAKRTLSSATQASIEIDSLFDGIDYSTTITRARFEDINMDYFKKCIDPVDKVLQDAKI 154 Query: 186 DKAQIHDIVLVGGSTRIPKVQKL 254 K+ +H+IVLVGGSTRIPKVQ+L Sbjct: 155 GKSAVHEIVLVGGSTRIPKVQQL 177 Score = 31.1 bits (67), Expect = 0.009 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +2 Query: 236 PQGAEALQDFFNGKELNKSINPDE 307 P+ + + ++FNGKE +SINPDE Sbjct: 172 PKVQQLITEYFNGKEPCRSINPDE 195 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 95.5 bits (227), Expect = 4e-22 Identities = 47/84 (55%), Positives = 62/84 (73%) Frame = +3 Query: 9 ERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNADLFRSTMEPVEKSLRDAKMD 188 E+AKR LSS + ++ I++L DF ++TRA+FEELN D F T++PV+K L DA M Sbjct: 95 EKAKRDLSSVHKTTLTIENLLADYDFSETLTRAKFEELNNDQFLKTLKPVKKVLEDADMT 154 Query: 189 KAQIHDIVLVGGSTRIPKVQKLCK 260 K QI +IVLVGGSTRIPK+Q+L K Sbjct: 155 KDQIDEIVLVGGSTRIPKIQQLIK 178 Score = 37.1 bits (82), Expect = 1e-04 Identities = 14/24 (58%), Positives = 20/24 (83%) Frame = +2 Query: 236 PQGAEALQDFFNGKELNKSINPDE 307 P+ + ++DFF+GKELN+ INPDE Sbjct: 171 PKIQQLIKDFFDGKELNRGINPDE 194 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 27.1 bits (57), Expect = 0.15 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -3 Query: 201 GFEPY-PSWHHGETSPLAPW*T*TDRRSAPRSEHE 100 GF P+ PS H G P PW T D R + H+ Sbjct: 468 GFGPWKPSMHGGVCDPYTPWHTFYDYRPWVQHGHQ 502 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = +1 Query: 580 FELTGIPPAPRGVPQIEVTFDIDANGILNGFRYREVH 690 + G+ A V I+ D+D NG N ++ H Sbjct: 56 YSFIGVNDADWSVLVIDPELDVDQNGFRNFTNLKKTH 92 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 216 PVQYRGFEPYPSWHHGETSPLAP 148 PV P+ + HHG T P +P Sbjct: 17 PVVLDVIPPHYNIHHGATPPQSP 39 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 260 DFFNGKELNKSINPDE 307 DF NGK L++S D+ Sbjct: 18 DFVNGKTLHRSTRDDK 33 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,198 Number of Sequences: 336 Number of extensions: 3427 Number of successful extensions: 17 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -