BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0536.Seq (722 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974171-1|ABJ52811.1| 403|Anopheles gambiae serpin 14 protein. 25 1.8 AY748847-1|AAV28193.1| 104|Anopheles gambiae cytochrome P450 pr... 25 3.1 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 9.6 >DQ974171-1|ABJ52811.1| 403|Anopheles gambiae serpin 14 protein. Length = 403 Score = 25.4 bits (53), Expect = 1.8 Identities = 8/25 (32%), Positives = 18/25 (72%) Frame = -3 Query: 717 VMVILFSLLVDFSIAETVEDTVGID 643 ++V +FS+ +F+ + + DT+G+D Sbjct: 290 IVVPVFSIKTEFNATDFLRDTIGLD 314 >AY748847-1|AAV28193.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 24.6 bits (51), Expect = 3.1 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +3 Query: 195 QIHDIV--LVGGSTRIPKVQKLCKISLMERSSTNLLTL 302 Q+H + + GGS R P ++ L ++ L+ER L L Sbjct: 60 QVHQEIDSIFGGSDRAPTMRDLNEMKLLERCLKETLRL 97 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 9.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 213 VQYRGFEPYPSWHHGE 166 + Y GFEPY H G+ Sbjct: 1335 ISYYGFEPYERNHFGK 1350 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 716,094 Number of Sequences: 2352 Number of extensions: 13831 Number of successful extensions: 28 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -