BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0535.Seq (550 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.67 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 2.0 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 23 2.7 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.6 bits (51), Expect = 0.67 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 219 GIETAGGVMTTLSSVTLPSPLNRLRHSPP 305 G + G V + +T PSP R R++PP Sbjct: 972 GCQPGGVVQSQQPIMTDPSPFKRGRYTPP 1000 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 Query: 306 TLITNPEYSSKYLR 347 T I N YSSKY+R Sbjct: 199 TYIVNTNYSSKYMR 212 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 22.6 bits (46), Expect = 2.7 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +3 Query: 9 HDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDE 116 +D ++VGG V L + N K L PDE Sbjct: 69 YDFIVVGGGAARAVVAGRLSEVSNWKVLLLEAGPDE 104 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,756 Number of Sequences: 438 Number of extensions: 2823 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -