BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0534.Seq (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_8757| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 5.3 >SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2680 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = -3 Query: 716 ELRQKSGPVQTLTFKSSDLSKYFSEVSHLTIH 621 ELRQKSG ++T+ ++ + L K +++ T++ Sbjct: 2290 ELRQKSGDLETVVYRGNGLEKLVTDLKPYTLY 2321 >SB_8757| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 539 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 7/43 (16%) Frame = -3 Query: 677 FKSSDLSKYFSEVSHLTIHS-------IIKCIFC*EKFSVTLY 570 FK + +K FS+ SHLT+H+ KC C + FS + Y Sbjct: 409 FKCKECAKCFSQYSHLTVHTRTHSGEKPFKCTDCDKTFSHSQY 451 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,168,387 Number of Sequences: 59808 Number of extensions: 274944 Number of successful extensions: 502 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 487 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -