BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0532.Seq (570 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_49500| Best HMM Match : Collagen (HMM E-Value=1.8e-07) 29 3.5 SB_5975| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_41539| Best HMM Match : PUD (HMM E-Value=0.42) 28 4.7 SB_40922| Best HMM Match : JmjC (HMM E-Value=0.092) 28 4.7 SB_31380| Best HMM Match : zf-CCHC (HMM E-Value=4.6e-05) 28 4.7 SB_10506| Best HMM Match : DNA_pol3_beta (HMM E-Value=4.9) 28 4.7 SB_7613| Best HMM Match : DNA_pol3_beta (HMM E-Value=4.9) 28 4.7 SB_31994| Best HMM Match : CPSase_L_chain (HMM E-Value=0) 28 6.2 SB_40268| Best HMM Match : NO_synthase (HMM E-Value=0) 28 6.2 SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) 27 8.2 SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29) 27 8.2 SB_4869| Best HMM Match : Coprinus_mating (HMM E-Value=2.8) 27 8.2 SB_4257| Best HMM Match : Collagen (HMM E-Value=0.00073) 27 8.2 SB_3026| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_39066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 29.1 bits (62), Expect = 2.7 Identities = 19/61 (31%), Positives = 25/61 (40%), Gaps = 2/61 (3%) Frame = +1 Query: 247 ISFGATVVCFELMEDGH--RFPASISRRQTAANQSETSQNEAQGAGDRPPGPRASRGVRG 420 + VV L+ED H R S+ R++ Q + PPG R RG RG Sbjct: 224 VDLAQVVVMSNLIEDEHISRAVISLLRQKWVDGQKGDRGDMGPPGHPGPPGVRGRRGKRG 283 Query: 421 P 423 P Sbjct: 284 P 284 >SB_49500| Best HMM Match : Collagen (HMM E-Value=1.8e-07) Length = 621 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +1 Query: 349 TSQNEAQ-GAGDRPPGPRASRGVRGP 423 TS E+Q G+G RP GP +G GP Sbjct: 20 TSGTESQPGSGQRPQGPNGPQGPNGP 45 >SB_5975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 28.7 bits (61), Expect = 3.5 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 449 DVIFVHGLYGSLSNTWRQ 502 D++FVHGL G TWR+ Sbjct: 36 DIVFVHGLRGGPLKTWRR 53 >SB_41539| Best HMM Match : PUD (HMM E-Value=0.42) Length = 1582 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 225 GNVRLHPYFIRCYGGVLRAYGG 290 G VR + +R YGG +R+YGG Sbjct: 80 GTVRSYGGTVRSYGGTVRSYGG 101 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 225 GNVRLHPYFIRCYGGVLRAYGG 290 G VR + +R YGG +R+YGG Sbjct: 87 GTVRSYGGTVRSYGGTVRSYGG 108 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 225 GNVRLHPYFIRCYGGVLRAYGG 290 G VR + +R YGG +R+YGG Sbjct: 94 GTVRSYGGTVRSYGGTVRSYGG 115 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 225 GNVRLHPYFIRCYGGVLRAYGG 290 G VR + +R YGG +R+YGG Sbjct: 101 GTVRSYGGTVRSYGGTVRSYGG 122 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 225 GNVRLHPYFIRCYGGVLRAYGG 290 G VR + +R YGG +R+YGG Sbjct: 108 GTVRSYGGTVRSYGGTVRSYGG 129 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 225 GNVRLHPYFIRCYGGVLRAYGG 290 G VR + +R YGG +R+YGG Sbjct: 115 GTVRSYGGTVRSYGGTVRSYGG 136 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 225 GNVRLHPYFIRCYGGVLRAYGG 290 G VR + +R YGG +R+YGG Sbjct: 122 GTVRSYGGTVRSYGGTVRSYGG 143 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 225 GNVRLHPYFIRCYGGVLRAYGG 290 G VR + +R YGG +R+YGG Sbjct: 129 GTVRSYGGTVRSYGGTVRSYGG 150 >SB_40922| Best HMM Match : JmjC (HMM E-Value=0.092) Length = 403 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -3 Query: 400 HGVQVVGPRHPELRFDWSRF-DLRQSDGD*SMQENGDRPP 284 H VQ GPR+ + W+RF Q+D D S+ ++ D P Sbjct: 246 HQVQSFGPRNLAVNIWWARFTQFNQTDCDTSIYKDKDLVP 285 >SB_31380| Best HMM Match : zf-CCHC (HMM E-Value=4.6e-05) Length = 1082 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +1 Query: 235 DCTRISFGATVVCFELMEDGHRFPASISRRQTAANQSETSQNEAQ 369 DC S+G V +M+DG P + + R ++++ +Q E + Sbjct: 579 DCDASSYGIGAVLSHVMDDGQERPIAYASRTLSSSEKNYAQIERE 623 >SB_10506| Best HMM Match : DNA_pol3_beta (HMM E-Value=4.9) Length = 666 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +1 Query: 235 DCTRISFGATVVCFELMEDGHRFPASISRRQTAANQSETSQNEAQ 369 DC S+G V +M+DG P + + R ++++ +Q E + Sbjct: 188 DCDASSYGIGAVLSHVMDDGQERPIAYASRTLSSSEKNYAQIERE 232 >SB_7613| Best HMM Match : DNA_pol3_beta (HMM E-Value=4.9) Length = 641 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +1 Query: 235 DCTRISFGATVVCFELMEDGHRFPASISRRQTAANQSETSQNEAQ 369 DC S+G V +M+DG P + + R ++++ +Q E + Sbjct: 297 DCDASSYGIGAVLSHVMDDGQERPIAYASRTLSSSEKNYAQIERE 341 >SB_31994| Best HMM Match : CPSase_L_chain (HMM E-Value=0) Length = 945 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +2 Query: 326 RLPQ-IKARPVKTKLRVPGTDHLDPV 400 R PQ + A P+KT R P T H DP+ Sbjct: 30 RTPQTVHADPLKTYTRTPQTVHADPI 55 >SB_40268| Best HMM Match : NO_synthase (HMM E-Value=0) Length = 465 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 234 RLHPYFIRCYGGVLRAYGGRSP 299 R+H RC G ++R YGG +P Sbjct: 199 RMHCTAARCEGSLMRPYGGENP 220 >SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37) Length = 732 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +1 Query: 238 CTRISFGATVVCFELMEDGHRFPASISRRQTAANQSETSQNEAQGA 375 C +G V +MEDG P + R + ++ SQ + +GA Sbjct: 316 CDASQYGLGAVLSHIMEDGSERPIGFASRTLSDAENNYSQLDKEGA 361 >SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29) Length = 1544 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +1 Query: 238 CTRISFGATVVCFELMEDGHRFPASISRRQTAANQSETSQNEAQGA 375 C +G V +MEDG P + R + ++ SQ + +GA Sbjct: 715 CDASQYGLGAVLSHIMEDGSERPIGFASRTLSDAENNYSQLDKEGA 760 >SB_4869| Best HMM Match : Coprinus_mating (HMM E-Value=2.8) Length = 796 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/64 (21%), Positives = 27/64 (42%) Frame = +1 Query: 253 FGATVVCFELMEDGHRFPASISRRQTAANQSETSQNEAQGAGDRPPGPRASRGVRGPARA 432 F ++ F+++ H +S RR +A + +N + P P +S+G + Sbjct: 307 FDLSMSAFDIIGSKHETFSSKIRRVQSAGTKRSKENPTGARNEPKPRPASSKGTMNTQKR 366 Query: 433 AFSY 444 SY Sbjct: 367 PSSY 370 >SB_4257| Best HMM Match : Collagen (HMM E-Value=0.00073) Length = 863 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 4/39 (10%) Frame = +1 Query: 319 RRQTAANQSETSQNEAQGAGDR----PPGPRASRGVRGP 423 ++ A Q S A GDR PPGPR G +GP Sbjct: 472 QKAVADRQENKSHGAAGPKGDRGPAGPPGPRGLPGAQGP 510 >SB_3026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 915 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +1 Query: 238 CTRISFGATVVCFELMEDGHRFPASISRRQTAANQSETSQNEAQGA 375 C +G V +MEDG P + R + + SQ + +GA Sbjct: 603 CDATHYGLGAVLSHIMEDGSERPVGFASRTLSDAEKNYSQLDKEGA 648 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,758,632 Number of Sequences: 59808 Number of extensions: 380959 Number of successful extensions: 1166 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1002 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1158 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -